KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108521978
Entry
108521978         CDS       T04641                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04630  JAK-STAT signaling pathway
rbb04640  Hematopoietic cell lineage
rbb04664  Fc epsilon RI signaling pathway
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05221  Acute myeloid leukemia
rbb05310  Asthma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108521978 (IL3)
   04151 PI3K-Akt signaling pathway
    108521978 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108521978 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108521978 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108521978 (IL3)
   04664 Fc epsilon RI signaling pathway
    108521978 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108521978 (IL3)
   05202 Transcriptional misregulation in cancer
    108521978 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108521978 (IL3)
  09163 Immune disease
   05310 Asthma
    108521978 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108521978 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108521978 (IL3)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108521978 (IL3)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Haparin
  Cytokines
   108521978 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 108521978
NCBI-ProteinID: XP_017717571
LinkDB
Position
Un
AA seq 143 aa
MSRLPILLLLHLLVSPGLQAPMTQTTSLKTSWANCSNMIDEIITHLKQPPLPSSDFNNLS
GEDQAILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRHPIRITN
GDRNDFRRKLKFYLKTLENEQAQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccatcctgctcctgctccatctcctggtcagccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggctaactgctctaacatgatcgat
gaaatcataacacacttaaaacagccacctttgccttcgtcggacttcaacaacctcagt
ggggaagaccaagccattctggtggaaaaaaatcttcgaaggtcaaacctggaggcattc
agtaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ccgccatgcctgcccatggccacggccgcacccacgcgacatccaatccgtatcacgaac
ggtgaccggaatgacttccggaggaaactgaagttctacctgaaaacccttgagaatgag
caggctcaatag

DBGET integrated database retrieval system