KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522039
Entry
108522039         CDS       T04641                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04144  Endocytosis
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04520  Adherens junction
rbb04540  Gap junction
rbb04630  JAK-STAT signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108522039 (EGFR)
   04012 ErbB signaling pathway
    108522039 (EGFR)
   04014 Ras signaling pathway
    108522039 (EGFR)
   04015 Rap1 signaling pathway
    108522039 (EGFR)
   04630 JAK-STAT signaling pathway
    108522039 (EGFR)
   04066 HIF-1 signaling pathway
    108522039 (EGFR)
   04068 FoxO signaling pathway
    108522039 (EGFR)
   04020 Calcium signaling pathway
    108522039 (EGFR)
   04072 Phospholipase D signaling pathway
    108522039 (EGFR)
   04151 PI3K-Akt signaling pathway
    108522039 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108522039 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108522039 (EGFR)
   04520 Adherens junction
    108522039 (EGFR)
   04540 Gap junction
    108522039 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108522039 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108522039 (EGFR)
   04915 Estrogen signaling pathway
    108522039 (EGFR)
   04921 Oxytocin signaling pathway
    108522039 (EGFR)
   04926 Relaxin signaling pathway
    108522039 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    108522039 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108522039 (EGFR)
   05206 MicroRNAs in cancer
    108522039 (EGFR)
   05205 Proteoglycans in cancer
    108522039 (EGFR)
   05230 Central carbon metabolism in cancer
    108522039 (EGFR)
   05231 Choline metabolism in cancer
    108522039 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108522039 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108522039 (EGFR)
   05212 Pancreatic cancer
    108522039 (EGFR)
   05225 Hepatocellular carcinoma
    108522039 (EGFR)
   05226 Gastric cancer
    108522039 (EGFR)
   05214 Glioma
    108522039 (EGFR)
   05218 Melanoma
    108522039 (EGFR)
   05219 Bladder cancer
    108522039 (EGFR)
   05215 Prostate cancer
    108522039 (EGFR)
   05213 Endometrial cancer
    108522039 (EGFR)
   05224 Breast cancer
    108522039 (EGFR)
   05223 Non-small cell lung cancer
    108522039 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108522039 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108522039 (EGFR)
   05171 Coronavirus disease - COVID-19
    108522039 (EGFR)
   05163 Human cytomegalovirus infection
    108522039 (EGFR)
   05165 Human papillomavirus infection
    108522039 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108522039 (EGFR)
   01522 Endocrine resistance
    108522039 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108522039 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108522039 (EGFR)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108522039 (EGFR)
Protein kinases [BR:rbb01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   108522039 (EGFR)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108522039 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   108522039 (EGFR)
  Exosomal proteins of bladder cancer cells
   108522039 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 108522039
NCBI-ProteinID: XP_017717628
UniProt: A0A2K6MNL0
LinkDB
Position
Un
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSNFLSNMSMDF
QNHLGSCQKCDPGCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGSGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctatgtgcagaggaattacgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacactgtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcaactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaggctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgtggcaagtcccccagtgattgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacgtaccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgcggggcggacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggaccttcatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattgcgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggtgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacaggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctatggatgcactgggtcaggtcttgaaggctgtgcaaggaacggg
cctaagatcccgtccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctaggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccaaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagcttatcacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacagattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgattattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtagatgccgacgagtacctcatcccacag
cagggcttcttcagcagcccctccacatcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cctgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system