KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522131
Entry
108522131         CDS       T04641                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04110  Cell cycle
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108522131 (E2F3)
   04218 Cellular senescence
    108522131 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108522131 (E2F3)
   05206 MicroRNAs in cancer
    108522131 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108522131 (E2F3)
   05225 Hepatocellular carcinoma
    108522131 (E2F3)
   05226 Gastric cancer
    108522131 (E2F3)
   05214 Glioma
    108522131 (E2F3)
   05220 Chronic myeloid leukemia
    108522131 (E2F3)
   05218 Melanoma
    108522131 (E2F3)
   05219 Bladder cancer
    108522131 (E2F3)
   05215 Prostate cancer
    108522131 (E2F3)
   05224 Breast cancer
    108522131 (E2F3)
   05222 Small cell lung cancer
    108522131 (E2F3)
   05223 Non-small cell lung cancer
    108522131 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108522131 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108522131 (E2F3)
   05161 Hepatitis B
    108522131 (E2F3)
   05160 Hepatitis C
    108522131 (E2F3)
   05163 Human cytomegalovirus infection
    108522131 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108522131 (E2F3)
   05169 Epstein-Barr virus infection
    108522131 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108522131 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108522131 (E2F3)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    108522131 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 108522131
NCBI-ProteinID: XP_017717695
UniProt: A0A2K6MXH2
LinkDB
Position
Un
AA seq 465 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI
LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG
RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD
TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP
MKTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEG
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgctctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agcccaggcttcgccgccgccgccgccgctgccgccgccccgggcgcgtacatccagatc
ctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgccgtagcc
gccggccccctcctccccagtgcccccggcgcggagcagaccgccggcagcctcctctac
accacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagccctggga
cgcggcggcagcggcggcggcggcggccctccggcaaagcgaaggctggagctaggagaa
agtggtcatcagtacctctcagatggtttaaaaacccccaagggcaaaggaagagctgca
ctgcgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacgcggtatgat
acgtctcttggtctgctcaccaagaagttcattcagctcctgagccagtcacccgatggg
gtcttggatttgaacaaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgat
atcaccaacgttctggaaggcatccacctcattaagaagaagtctaaaaacaacgtccaa
tggatgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtca
aaagaagtgactgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgc
accctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttaca
tatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcc
cctccagaaacaagacttgaagtgcctgactcaatagagagcctacaaatacatttggca
agtacccaagggcccattgaggtttacttatgtccagaagagactgaaacacacagtcca
atgaaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagacttg
gcttcaaccaactcaggacatagcgattgctcaatttctatgggaaacctttctcctttg
gcctccccagccaacctcttacagcagactgaggaccaaattccttccaacctagaagga
ccgtttgtgaacttactgcctcccctgctgcaagaggactatctcctgagcctcggggag
gaggaaggcatcagcgatctctttgatgcttacgatttggaaaagctcccactggtggaa
gacttcatgtgtagttga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533038
Entry
108533038         CDS       T04641                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04110  Cell cycle
rbb04137  Mitophagy - animal
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108533038 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    108533038 (E2F1)
   04218 Cellular senescence
    108533038 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108533038 (E2F1)
   05206 MicroRNAs in cancer
    108533038 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108533038 (E2F1)
   05225 Hepatocellular carcinoma
    108533038 (E2F1)
   05226 Gastric cancer
    108533038 (E2F1)
   05214 Glioma
    108533038 (E2F1)
   05220 Chronic myeloid leukemia
    108533038 (E2F1)
   05218 Melanoma
    108533038 (E2F1)
   05219 Bladder cancer
    108533038 (E2F1)
   05215 Prostate cancer
    108533038 (E2F1)
   05224 Breast cancer
    108533038 (E2F1)
   05222 Small cell lung cancer
    108533038 (E2F1)
   05223 Non-small cell lung cancer
    108533038 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108533038 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108533038 (E2F1)
   05161 Hepatitis B
    108533038 (E2F1)
   05160 Hepatitis C
    108533038 (E2F1)
   05163 Human cytomegalovirus infection
    108533038 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108533038 (E2F1)
   05169 Epstein-Barr virus infection
    108533038 (E2F1)
   05165 Human papillomavirus infection
    108533038 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108533038 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108533038 (E2F1)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    108533038 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 108533038
NCBI-ProteinID: XP_017732892
LinkDB
Position
Un
AA seq 559 aa
MNEFKPTLYVGCWRFWLKWDLQESSTWPRHFQPPLFSLGSGNRSRRRRSRHGPLGANCGG
TLGGSWLFSRQKGFGAVKVAGLCRQRGGPGAERDRALAGAAAMGPAAPPPVTWGAARAVR
SCLGRAPLRGGHGAPALEALLGAGALRLLDSSQIVIISAAQDARAPRLPPAPRRPAAGRP
CDPDLLPLRTPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKG
VKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQ
LIAKKSKNHIQWLGSHTTVGVSGRLEGLTEDLRQLQESEQQLDHLMNICTTQLRLLSEDT
DSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLC
PEETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPL
LSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEG
EGIRDLFDCDFGDLTPLDF
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaatgagttcaagccgacgctatacgttggctgttggagattttggctaaaatgggac
ttgcaggaaagctcgacgtggccccgccatttccagccaccgctcttcagcttgggctct
ggcaataggagccgccgccgtcgttctcgtcacggcccactgggcgccaattgtggcggc
acgctcggcggctcgtggctcttttcgcggcaaaaaggatttggcgccgtaaaagtggcc
ggactttgcaggcaacgcggcgggccgggggcggagcgggatcgagccctcgccggggcc
gccgccatgggcccggccgcgccgccgcctgtaacctggggggccgcgcgggccgtgagg
tcatgccttggccgggcgcccctgcggggcggccatggcgcgccggcgctggaggccctg
ctcggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctgccgcg
caggacgccagggccccgcggctcccaccggccccgcggcgccccgccgccggccggccc
tgcgaccctgacctgctgcctcttcgcacaccgcaggcgccccggcccacacccagtgcg
ccgcgccccgcgctcggccgcccgccggtgaagcggaggttggacctggaaactgaccat
cagtacctggcggagagcagtgggccagctcggggcagaggccgccatccaggaaaaggt
gtgaaatccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgc
ttcctggagctgctgagccgctcggctgacggtgtcgtcgacctgaactgggctgctgag
gtgctgaaagtgcagaagcggcgcatctatgacatcaccaacgtcctcgagggcatccag
ctcattgccaagaagtccaagaaccacatccagtggctgggtagccacaccacagtgggc
gtcagcgggcggcttgaggggttgaccgaggacctccggcagctgcaggagagcgagcag
cagctggaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggatact
gacagccagcgcctggcctatgtgacgtgtcaggaccttcgtagcattgcagaccctgca
gagcagatggttatggtgatcaaagcccctcccgagacccagctccaagccgtggactct
tcggagacctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgc
cctgaggagaccgtgggtgggatcagccctgggaagaccccgtcccaggaggccacttct
gaggaggagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctccc
ccctcatccctcaccacagatcccagtcagtctctactcagcctggagcaagaaccgctg
ttgtcccggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtg
gcggccgactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggag
ttcatcagcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggt
gagggcatcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538448
Entry
108538448         CDS       T04641                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04110  Cell cycle
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108538448 (E2F2)
   04218 Cellular senescence
    108538448 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538448 (E2F2)
   05206 MicroRNAs in cancer
    108538448 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108538448 (E2F2)
   05225 Hepatocellular carcinoma
    108538448 (E2F2)
   05226 Gastric cancer
    108538448 (E2F2)
   05214 Glioma
    108538448 (E2F2)
   05220 Chronic myeloid leukemia
    108538448 (E2F2)
   05218 Melanoma
    108538448 (E2F2)
   05219 Bladder cancer
    108538448 (E2F2)
   05215 Prostate cancer
    108538448 (E2F2)
   05224 Breast cancer
    108538448 (E2F2)
   05222 Small cell lung cancer
    108538448 (E2F2)
   05223 Non-small cell lung cancer
    108538448 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108538448 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108538448 (E2F2)
   05161 Hepatitis B
    108538448 (E2F2)
   05160 Hepatitis C
    108538448 (E2F2)
   05163 Human cytomegalovirus infection
    108538448 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108538448 (E2F2)
   05169 Epstein-Barr virus infection
    108538448 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108538448 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108538448 (E2F2)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    108538448 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 108538448
NCBI-ProteinID: XP_017742032
UniProt: A0A2K6M907
LinkDB
Position
Un
AA seq 437 aa
MLQGPRALVSAAGQPPKVVPAMSPTELWPSGLSSPQLCPATTTYYTPLYPQTAPPAVAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKI
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNMEEALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDPAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggtttcggccgctgggcagcccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgctgtacccgcagacggcgcctcccgcagtggcgcccggc
acctgcctcgacgccactccccacggacccgagggccaagttgttcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaatc
cccaaatcccctggggagaagactcggtatgacacttcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgcttgagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatg
gaggaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgcct
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcccctcccctct
acctccaccctctgccccagccctgaccctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcatgcagctcccctctg
atcagcttctccccgtccttggatcaggatgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgacctcggggacctgttgattaattga

DBGET integrated database retrieval system