KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522276Help
Entry
108522276         CDS       T04641                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00250  Alanine, aspartate and glutamate metabolism
rbb00410  beta-Alanine metabolism
rbb00430  Taurine and hypotaurine metabolism
rbb00650  Butanoate metabolism
rbb01100  Metabolic pathways
rbb04727  GABAergic synapse
rbb04940  Type I diabetes mellitus
Module
rbb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108522276 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108522276 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108522276 (GAD1)
   00430 Taurine and hypotaurine metabolism
    108522276 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    108522276 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    108522276 (GAD1)
Enzymes [BR:rbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108522276 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 108522276
NCBI-ProteinID: XP_017717860
UniProt: A0A2K6MQM7
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDGDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcgtctgcaacctcctcgaacgcgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcctgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagtgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagcgacggggatgcccgcttccggcgcacagagacggacttctccaacctgtttgct
agagatctgcttccggctaagaacggggaggagcaaactgtgcaattcctcctggaagtg
gtggacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccttgaagtatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggccta
gctggagaatggctgacatcaacagccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtactcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaaaataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacaactgtttatggagcttttgatccgatacaagagatcgca
gatatatgtgagaaatacaacctttggctgcatgtagatgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaatggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgttgcagtgctctgccattctcgtcaaagaa
aagggtatactccaaggatgcaaccagatgtgtgcaggataccttttccagccagacaag
cagtatgatgtctcctacgacactggggacaaggcaattcagtgtggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctacgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgagcacacaaacgtctgtttttggtatattccacaa
agcctcaggggtgtgccggacagccctcaacgacgggaaaagctacacaaggtggctcca
aaaatcaaagccctgatgatggagtcaggcacgaccatggttggctaccagccccagggg
gacaaggccaacttcttccggatggtcatctctaacccagccgctacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system