KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522504
Entry
108522504         CDS       T04641                                 

Gene name
PRKCE
Definition
(RefSeq) protein kinase C epsilon
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04022  cGMP-PKG signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04371  Apelin signaling pathway
rbb04530  Tight junction
rbb04666  Fc gamma R-mediated phagocytosis
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04925  Aldosterone synthesis and secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108522504 (PRKCE)
   04071 Sphingolipid signaling pathway
    108522504 (PRKCE)
   04022 cGMP-PKG signaling pathway
    108522504 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108522504 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    108522504 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    108522504 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108522504 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108522504 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108522504 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108522504 (PRKCE)
   04931 Insulin resistance
    108522504 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108522504 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108522504 (PRKCE)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108522504 (PRKCE)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108522504 (PRKCE)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 108522504
NCBI-ProteinID: XP_017718215
UniProt: A0A2K6MYH2
LinkDB
Position
Un
AA seq 737 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPLKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccgcagactttccttctcgacccc
tacattgctctcaatgtggacgactcgcgcattggccaaacggccaccaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgatgtgtgcaacgggcgcaagatcgag
ctggctgtctttcacgatgcccccataggctacgacgacttcgtagccaactgcaccatc
cagtttgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggaagagtgtatgtgatcatcgatctctcagggtcgtcgggtgaagcccctaaa
gacaatgaagagcgcgtgttcagggaacgcatgcggccgagaaagcggcagggagccgtc
aggcgcagggtccatcaggtcaacggccacaagttcatggccacctatcttcggcagccc
acctactgctcccactgcagagacttcatctggggtgtcataggaaagcagggataccag
tgtcaagtttgcacctgtgtggtccacaagcggtgccatgagcttatcatcaccaagtgc
gctgggttaaagaagcaggagacccccgaccaggtgggctcccagcggttcagtgtcaac
atgccccacaagttcggcatccacaactacaaggtccccaccttctgcgatcactgtggg
tccctcctctggggcctcttgcggcagggtttgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgtgagaccaacgtggctcccaactgtggagtggatgccagaggaatcgcc
aaagtgctggctgacctgggcgttaccccagacaaaatcaccaacagcggccagaggagg
aaaaagctcattgctggtgccgagtccccgcaacctgcttctggaagctcaccatctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaaataaaagaacttgag
aacaacattcgaaaagccttgtcatttgacaaccgaggggaggagcaccgggcagcatca
tctcctgatggccagctgatgagccctggtgagaacggcgaagtccggcaaggccaggcc
aagcgcctgggcctggatgagttcaacttcatcaaggtgttgggcaaaggcagctttggc
aaggtcatgctggcagaactcaagggcaaagatgaagtatatgctgtgaaggtcttaaag
aaggatgtcatccttcaggatgatgacgtggactgcacaatgacagagaagaggattttg
gctctggcacggaaacacccttaccttacccaactctactgctgcttccagaccaaggac
cgcctctttttcgtcatggaatatgtaaatggtggagacctcatgtttcagattcagcgc
tcccgaaaatttgatgagcctcgttcacggttctatgctgcagaggtcacgtcggccctc
atgttcctccaccagcatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggctgactttgggatgtgcaaggaagggattctgaat
ggtgtgacgaccaccaccttctgtgggactcctgactacatagctcccgagatcctgcag
gagttggagtacggcccctccgtggactggtgggccctgggggtgctgatgtacgagatg
atggctggacagcctccctttgaggccgacaacgaggacgacctatttgagtccatcctc
catgacgacgtgctgtacccagtctggctcagcaaggaggcggtcagcatcttgaaagct
ttcatgacaaagaatcccctcaagcgcctgggctgcgtggcatcgcagaacggcgaggac
gccatcaagcagcacccattcttcaaagagattgactgggtgctcctggagcagaagaag
atcaagccacccttcaaaccacgcattaaaaccaaaagagacgtcaataattttgaccaa
gactttacccgggaagagccggtactcacccttgtggacgaagcaattgtaaagcagatc
aaccaggaggaattcaaaggcttctcctacttcggtgaagacctgatgccctga

DBGET integrated database retrieval system