KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522695
Entry
108522695         CDS       T04641                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04260  Cardiac muscle contraction
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04742  Taste transduction
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04927  Cortisol synthesis and secretion
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108522695 (CACNA1C)
   04020 Calcium signaling pathway
    108522695 (CACNA1C)
   04024 cAMP signaling pathway
    108522695 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    108522695 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108522695 (CACNA1C)
   04929 GnRH secretion
    108522695 (CACNA1C)
   04912 GnRH signaling pathway
    108522695 (CACNA1C)
   04921 Oxytocin signaling pathway
    108522695 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    108522695 (CACNA1C)
   04924 Renin secretion
    108522695 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    108522695 (CACNA1C)
   04927 Cortisol synthesis and secretion
    108522695 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108522695 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    108522695 (CACNA1C)
   04270 Vascular smooth muscle contraction
    108522695 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    108522695 (CACNA1C)
   04727 GABAergic synapse
    108522695 (CACNA1C)
   04725 Cholinergic synapse
    108522695 (CACNA1C)
   04728 Dopaminergic synapse
    108522695 (CACNA1C)
   04726 Serotonergic synapse
    108522695 (CACNA1C)
   04720 Long-term potentiation
    108522695 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    108522695 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    108522695 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108522695 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108522695 (CACNA1C)
   05020 Prion disease
    108522695 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    108522695 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    108522695 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108522695 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108522695 (CACNA1C)
   05414 Dilated cardiomyopathy
    108522695 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108522695 (CACNA1C)
   04934 Cushing syndrome
    108522695 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108522695 (CACNA1C)
Ion channels [BR:rbb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108522695 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C DUF4834
Other DBs
NCBI-GeneID: 108522695
NCBI-ProteinID: XP_017718566
LinkDB
Position
Un
AA seq 2042 aa
MLRAFVQPGTPAYQPLPSHLSADTEVKFKGTLVHEAQLNYFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNRGTPAGMLDQKKGKFAWFRHSTETHVSMPTSETESVNTENVAGGDIE
GENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEH
YNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETIL
VETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIF
SLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFP
GMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPE
KKQEMVEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPETTGE
EDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNL
ILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFC
RNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVA
IRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPI
IQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDRGPIYNYRVEISIF
FIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPK
NQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVE
MILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVD
IAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSF
QALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEA
WQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMD
NFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHR
VACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEEGPSPSEAHQGAEDHFRPAGNL
EQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQG
LVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRR
AGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSY
SSTGSNANINNANNTGLGRPPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKLSSNRCHS
GESQAAMVGPEDTSQDETYEVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRD
IRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQVAHTFGQATV
SC
NT seq 6129 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctggtacgcctgcataccagccgcttcccagccacctg
tctgccgacacggaggtcaagtttaagggtactttggtgcatgaagctcaactcaactat
ttctacatctctcctggaggttccaactatgggagcccacgccccgcccatgccaacatg
aatgccaatgcggccgcgggactggcccctgagcacatccccaccccgggggccgccctg
tcctggcaggcggccattgacgcagcccggcaggctaagctgatgggcagtgctggcaat
gcgaccatctccacagtcagctccacgcagcggaagcgacagcaatacgggaagcccaag
aagcagggcagcaccacggccacacgcccgccccgagccctgctctgcctgaccctgaag
aaccccatccggagggcctgcatcagcattgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gattccaacgccactaattccaacctggaacgagtggaatatctctttctcataattttt
acggtggaagcatttttaaaagtcatcgcctatggactcctctttcaccccaatgcctac
ctccgcaacggctggaatctgctcgattttatcattgtggttgtggggctttttagtgca
attttagaacaagcaaccaaagcagacggggcaaatgctctcggagggaaaggggccgga
tttgatgtgaaagcgctgagggccttccgcgtgctgcgacccctgcggctggtgtccgga
gtcccaagtctccaggtggtcctgaattccatcatcaaggccatggtccccctgctgcac
atcgccctgctcgtgctgtttgtcatcatcatctacgccatcatcggcctggagctcttc
atggggaagatgcacaagacctgctacaaccaggagggcatagcagatgttccagcagaa
gatgacccttccccttgtgcgctggaaacaggccatgggcggcagtgccagaacggcacg
gtgtgcaagcccggctgggatggtcccaagcacggcatcaccaactttgacaactttgcc
ttcgccatgctcacggtgttccagtgcatcaccatggagggctggacggacgtgctgtac
tggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagggagaaggccaaggcccggggagatttccagaagctgcgggagaagcagcagcta
gaagaggatctcaaaggctacctggactggatcactcaggccgaagacatcgatcccgag
aatgaggacgaaggcatggatgaggagaagccccgaaacagaggcactccggcgggcatg
cttgatcagaagaaagggaagtttgcttggtttaggcactccacagaaacccatgtgagc
atgcccaccagtgagaccgagtccgtcaacaccgaaaacgtggctggaggtgacatcgag
ggagaaaactgcggggccaggctggcccaccggatctccaagtcaaagttcagccgctac
tggcgtcggtggaatcggttctgcagaagaaagtgccgtgctgcagtcaagtctaatgtc
ttctactggttggtgattttcctggtgttcctcaacacgctcaccattgcctctgagcac
tacaaccagccccactggctcacagaagtccaagacacagcgaacaaggccctgctcgcc
ctgttcacggcagagatgctcctgaagatgtacagcctgggcctgcaggcctacttcgtg
tccctcttcaaccgctttgactgcttcgtcgtgtgtggcggcatcctggagaccatcctg
gtggagaccaagatcatgtccccgctgggcatctccgtgctcagatgtgtccggttgctg
aggatattcaagatcacgaggtactggaactccttgagcaacctggtggcatccttgctg
aactctgtgcgctccatcgcctccctgctccttctcctcttcctcttcatcatcatcttc
tccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcagacccgg
aggagcacatttgataacttcccccagtccctcctcactgtgtttcagatcctgaccggg
gaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttcca
gggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatcctactg
aatgtgttcttggccattgctgtggacaacctggctgacgctgagagcctcacatctgcc
caaaaggaggaggaagaggagaaggagagaaagaagctggccaggactgccagcccagag
aagaaacaagagatggtagagaagccggcagtggaggaatccaaggaggagaagattgag
ctgaaatccatcacggctgacggagagtctccacccactaccaagatcaacatggatgac
ctccagcccaatgaaaatgaggataagagcccctaccccaacccagaaactacaggagaa
gaggatgaggaggagccagagatgcctgtcggccctcgcccacgaccactctctgagctt
caccttaaggaaaaggcagtgcccatgccagaagccagcgcgtttttcatcttcagctct
aacaacaggtttcgcctccagtgccaccgcattgtcaacgacacgatcttcaccaacctg
atcctcttcttcattctgctcagcagcatttccctggctgctgaggacccggtccagcac
acctccttcaggaaccatattctgttttattttgatattgtttttaccaccattttcacc
attgaaattgctctgaagatgacggcttatggggcgtttctgcacaagggctccttctgc
cggaactacttcaacatcctggacctgctggtggtcagcgtgtccctcatctcctttggc
atccagtccagtgcaatcaatgtcgtgaagatcttgcgagtcctgcgagtactcaggccc
ctgagggctatcaacagggccaaggggctaaagcatgtggttcagtgtgtgtttgtcgcc
atccggaccatcgggaacatcgtgattgtcaccaccctgctgcagttcatgttcgcctgc
atcggggtccagctcttcaagggaaagctgtacacctgttcagacagttccaagcagaca
gaggcggaatgcaagggcaactacatcacgtacaaagacggggaggttgaccaccccatc
atccaaccccgcagctgggagaacagcaagtttgactttgacaatgttctggcagccatg
atggccctcttcaccgtctccaccttcgaagggtggccagagctgctgtaccgctccatc
gactcccacactgaagacaggggtcccatctacaactaccgcgtggagatctccatcttc
ttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggcttcgtc
atcgtcaccttccaggagcagggggagcaggagtacaagaactgtgagctggacaagaac
cagcgacagtgtgtggaatacgccctcaaggcccggcccctgcggaggtatatccccaag
aaccagcaccagtacaaagtgtggtacgtggtcaactccacctatttcgagtacctgatg
ttcgtcctcatcctgctcaacaccatctgcctggccatgcagcactacggccagagctgc
ctgttcaaaatcgccatgaacatcctcaacatgctcttcactggcctcttcaccgtggag
atgatcctgaagctcattgccttcaaacccaagggttactttagtgatccctggaatgtt
tttgacttcctcatcgtaattggcagcataattgacgtcattctcagtgagactaatcac
tatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgat
atagcaatcaccgaggtaaacccagctgaacatacccaatgctctccctctatgaacgca
gaggaaaactcgcgcatctccatcaccttcttccgcctattccgggtcatgcgcctggtg
aagctgctgagccgcggggagggcatccggacgctgctgtggaccttcatcaagtccttc
caggccctgccctatgtggccctcctgatcgtgatgctgttcttcatctacgcggtgatc
gggatgcaggtgtttgggaaaattgccctgaatgataccacagagatcaaccggaacaac
aactttcagaccttcccccaggccgtgctgctcctcttcaggtgtgccaccggggaggcc
tggcaggacatcatgctggcctgcatgccaggcaagaagtgtgccccggagtccgagccc
agcaacagcacggagggtgaaacaccctgtggcagcagctttgccgtcttctacttcatc
agcttctacatgctctgtgccttcctgatcatcaacctctttgtagctgtcatcatggac
aactttgactacctgacaagggactggtccatccttggtccccaccacctggatgagttt
aaaagaatctgggcagagtatgaccctgaagccaagggtcgtatcaaacacctggatgtg
gtgaccctcctccggcggattcagcccccactaggttttgggaagctgtgccctcaccgc
gtggcttgcaaacgcctggtctccatgaacatgcctctgaacagcgacgggacggttatg
ttcaatgccaccctgtttgccctggtcaggacagccctgaggatcaaaacagaagaggga
cccagcccatcagaggcccaccaaggggctgaggatcatttccgccctgcagggaacctc
gaacaggccaatgaggagctgcgggccatcatcaagaagatctggaagcggaccagcatg
aagctgctggaccaggtggtgccccctgcaggcgatgatgaggtcaccgttggcaagttc
tacgccacgttcctgatccaggagtacttccggaagttcaagaagcgcaaagagcagggc
cttgtgggcaaaccctcccagaggaacgcgctgtctctgcaggctggcttgcgcacactg
catgacatcgggcctgagatccgacgggccatctctggagatctcaccgctgaggaggag
ctggacaaggccatgaaggaggctgtgtccgctgcttctgaagatgacatcttcaggagg
gccggtggcctgttcggcaaccacgtcagctactaccaaagcgacggccggagcgccttc
ccccagaccttcaccactcagcgcccactgcacatcaacaaggcgggcagcagccagggc
gacactgagtcgccgtcccatgagaagctggtggactccaccttcacccccagcagctac
tcgtccaccggctccaacgccaacatcaacaacgccaacaacaccgggctgggtcgcccc
cctcgccccgccggctaccccagcacagtcagcactgtggagggccatgggccccccttg
tcccctgccatccgggtgcaggaggtggcgtggaagctaagctccaacaggtgccactcc
ggggagagccaggcagccatggtgggtccagaggatacgtctcaggatgagacctatgaa
gtgaagatgaaccatgacacggaggcctgcagtgagcccagcctgctctccacagagatg
ctgtcctaccaggatgacgaaaatcggcaactgacgctcccagaggaggacaagagggac
atccggcaatccccaaagaggggtttcctccgctccgcctcactaggtcgaagggcctcc
ttccacctggaatgtctgaagcgacagaaggaccgagggggagacatctctcagaagaca
gtcctgcccttgcatctggttcatcatcaggtagctcacacttttggacaggccactgtc
tcctgctag

DBGET integrated database retrieval system