KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522967
Entry
108522967         CDS       T04641                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04066  HIF-1 signaling pathway
rbb04217  Necroptosis
rbb04380  Osteoclast differentiation
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05200  Pathways in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108522967 (IFNGR1)
   04066 HIF-1 signaling pathway
    108522967 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108522967 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108522967 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108522967 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    108522967 (IFNGR1)
   04659 Th17 cell differentiation
    108522967 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108522967 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108522967 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108522967 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108522967 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108522967 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    108522967 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    108522967 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108522967 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108522967 (IFNGR1)
   05140 Leishmaniasis
    108522967 (IFNGR1)
   05142 Chagas disease
    108522967 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rbb04050]
    108522967 (IFNGR1)
   04090 CD molecules [BR:rbb04090]
    108522967 (IFNGR1)
Cytokine receptors [BR:rbb04050]
 Interleukin receptor families
  IFN receptor family
   108522967 (IFNGR1)
CD molecules [BR:rbb04090]
 Proteins
  108522967 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 108522967
NCBI-ProteinID: XP_017718920
UniProt: A0A2K6LGN2
LinkDB
Position
Un
AA seq 489 aa
MALLFLLILVMQSVSRAEMVTADVGQSSVPIPTNVTIESYNMNTIVYWEYQSMPQVSVFT
VEVKNYGVKNAEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAESKEFA
VCRDGKIGPPKLDIRKEEKQIMIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SNIKGSLWIPVVAALLLFLVLSLVLICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKGEHTEELSSITEVVTTEE
NIPDMAPGSHLTPIERESSSPFSSNQSEPCSVALNSYHSRNCSDSDHSRNGFDTDSSCLE
SHNSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDGRKESLIGYR
PTEGSKEFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctctcctctttcttctgatccttgtcatgcagagtgtgagcagggctgagatggtc
accgcggatgtggggcagtcctcagtgcctataccaactaatgttacaattgagtcctat
aacatgaacaccatcgtatattgggagtaccagagcatgccacaggtctctgtttttact
gtagaggtaaagaactatggtgttaagaatgcagaatggattgatgcctgcatcaatatt
tctcatcattattgtaatatttctgatcatgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcagagtcaaaagaatttgct
gtgtgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatgattgacgtatttcacccttcagtttttgtaaatggagaagagcaggaagtcgat
tatgatccagaaactacctgttacattaaggtgtacaatgtgtatgtgagaatgaatgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgcgacgagattcagtgc
cagttagcgattccagtgtcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtatggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcaacataaaaggttctctttggattccagttgttgctgctttactactctttctagta
cttagcctggtattgatctgtttttatattaagaagattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtcagaagtgctactttagagacaaaacct
gaatcaaaatatgtatcactcatcacatcataccagccattttccttagaaaaggaggtg
gtctgtgaagagccgttgtctccagcaacagttccaggcatgcatactgaagacaatcca
ggaaaaggagagcatacagaagaactttctagtataacagaagtggtgactactgaagaa
aacattcctgacatggccccgggcagccatctgactccaatagagagagagagttcttca
cctttcagtagtaaccagtctgaaccctgcagcgtcgctttaaactcctatcactccaga
aattgttctgatagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacataactccttatctgattcagaatttcccccaaataataaaggtgaaataaaaaca
gaaggacaagagctcataacagtaataaaagcccccacctcctttggttatgataaaccg
cacgtgctagtggatctacttgtggatgatggccgtaaagagtccttgattggttacaga
ccaacagaaggttccaaagaattttcatga

DBGET integrated database retrieval system