KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523026
Entry
108523026         CDS       T04641                                 

Definition
(RefSeq) tyrosine-protein kinase JAK2-like
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04062  Chemokine signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04217  Necroptosis
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04630  JAK-STAT signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04725  Cholinergic synapse
rbb04917  Prolactin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05200  Pathways in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108523026
   04151 PI3K-Akt signaling pathway
    108523026
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108523026
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108523026
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108523026
   04659 Th17 cell differentiation
    108523026
   04062 Chemokine signaling pathway
    108523026
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108523026
   04917 Prolactin signaling pathway
    108523026
   04935 Growth hormone synthesis, secretion and action
    108523026
  09156 Nervous system
   04725 Cholinergic synapse
    108523026
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108523026
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108523026
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108523026
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108523026
  09172 Infectious disease: viral
   05161 Hepatitis B
    108523026
   05164 Influenza A
    108523026
   05168 Herpes simplex virus 1 infection
    108523026
   05167 Kaposi sarcoma-associated herpesvirus infection
    108523026
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108523026
   05140 Leishmaniasis
    108523026
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108523026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108523026
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108523026
Protein kinases [BR:rbb01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108523026
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl SH2 Kdo Kinase-like RIO1 APH
Other DBs
NCBI-GeneID: 108523026
NCBI-ProteinID: XP_017718969
LinkDB
Position
Un
AA seq 923 aa
MSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTF
LPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEK
FEVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIK
QANQEGSDESRVVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAP
PTVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEY
KHCLITKNENEEYNLSGTKKNFNSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKXKSNL
LVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKXFKGIRREVGD
YGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGEENILVAGVX
XKFGSLDTYLKTESKIVXIYVALELQNKLAWAMHFLEENTLIHGNVCAKNILLIREEDRK
TGNPPFIKLSESGISITVLPKEVLQERIPWVPPECIENPXNLNLATDKWSFGTTLWEICS
GGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSL
FTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRY
DPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLI
MEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENEN
RVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELF
TYIEKSKSPPAVSVLFIYFQFFV
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgtcttacctctttgctcagtggcggcatgattttgtgcatggatggataaaagtacct
gtgactcatgaaacacaggaagaatgtcttgggatggcagtgttagatatgatgagaata
gccaaagaaaatgatcaaaccccactggccatctataactctatcagctacaagacattc
ttaccaaaatgtattcgagcaaagatccaagactatcatattttgacaaggaagcgaata
aggtacagatttcgcagatttattcagcagttcagccaatgcaaagccactgccagaaac
ttgaaacttaagtatcttataaatctggaaaccctgcagtctgccttctacacagagaaa
tttgaagtaaaagaacctggaagtggtccttcaggtgaggagatttttgcaaccattata
ataactggaaacggtggaattcagtggtcaagagggaaacataaagaaagtgagacactg
acagaacaggatttacagttatattgcgattttcctaatattattgatgtcagtattaag
caagcaaaccaagagggttcagatgaaagccgagttgtaactatccataagcaagatggt
aaaaatctggaaattgaacttagctcattaagggaagctttgtctttcgtgtcattaatt
gatgggtattatagattaactgcagatgcacatcattacctctgtaaagaagtagcacct
ccaacagtgcttgaaaatatacaaagcaactgtcatggcccaatttcgatggattttgcc
attagtaaactgaagaaagcaggtaatcagactggactgtatgtacttcgatgcagtcct
aaggactttaataaatattttctgacttttgctgtcgagcgagaaaatgtcattgaatat
aaacactgtttgattacaaaaaatgagaatgaagagtacaacctcagtgggacaaagaag
aacttcaacagtcttaaagatcttttgaattgttaccagatggaaaccgttcgctcagac
aatataattttccagtttactaagtgctgtcccccaaagccaaaagntaaatcaaacctt
ctagtcttcagaacgaatggtgtttctgatgtaccaacctcaccaacattacagaggcct
actcatatgaaccaaatggtgtttcacaaaatcagaaatgaagatttgatatttaatgaa
agccttggccaaggcacttttacaaagnattttaaaggcatacgaagagaagtaggagac
tatggtcaactgcatgaaacagaagttcttttaaaagttctggataaagcacatagaaac
tattcagagtctttctttgaagcagcaagcatgatgagcaagctttctcacaagcatttg
gttttaaattatggagtatgtgtctgtggagaggagaatattctggttgcaggagtttga
taaaaatttggatcactagatacatacctgaaaacagaatcaaaaattgtataaatatat
gtggcacttgagttgcaaaacaagttggcatgggccatgcattttctagaagaaaacacc
cttattcatgggaatgtgtgcgccaaaaatattctacttatcagagaagaagacaggaag
acaggaaatcctcctttcatcaaacttagtgagtctggcattagtattacagttttgcca
aaagaagttcttcaggagagaataccatgggtaccacctgaatgcattgaaaatcctnaa
aatttaaatttggcaacagacaaatggagttttggtaccactttgtgggaaatctgcagt
ggaggagataaacctctaagtgctctggattctcaaagaaagctgcaattttatgaagat
aggcaccagcttcctgcaccaaagtgggcagaattagcaaaccttataaataattgtatg
gattatgagccagatttcaggccttctttcagagccatcatacgagatcttaacagtttg
tttactccagattatgaactattaacagaaaatgacatgttaccaaatatgaggataggt
gccctagggttttctggtgcctttgaagacagggatcctacacagtttgaagagagacat
ttgaaatttctacagcaactcggcaagggtaattttgggagtgtggagatgtgccggtat
gaccctctacaggacaacactggggaggtggtggctgtaaaaaagcttcagcatagtact
gaagagcacctgagagactttgaaagggaaattgaaatcctgaaatccctacagcatgac
aacattgtaaagtacaagggagtgtgctacagtgctggtcggcgtaatctaaaattaatt
atggaatatttaccatatggaagtttacgagactatcttcaaaaacataaagaacggata
gatcacaaaaaacttctgcagtacacatctcagatatgcaagggtatggagtatcttggt
acaaaaaggtatatccacagggatctggcaacaagaaatatattggtggagaatgagaac
agagttaaaattggagattttgggttaaccaaagtcttgccacaagacaaagaatactat
aaagtaaaagaacctggtgaaagtcccatattctggtatgccccagaatcactgacagag
agcaagttttctgtggcctcagatgtttggagctttggagtggttctgtatgaacttttc
acatacattgagaagagtaaaagtccaccagcggtcagtgtgcttttcatttactttcag
ttttttgtt

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532886
Entry
108532886         CDS       T04641                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04151  PI3K-Akt signaling pathway
rbb04217  Necroptosis
rbb04380  Osteoclast differentiation
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04621  NOD-like receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05212  Pancreatic cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108532886 (JAK1)
   04151 PI3K-Akt signaling pathway
    108532886 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108532886 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108532886 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108532886 (JAK1)
   04658 Th1 and Th2 cell differentiation
    108532886 (JAK1)
   04659 Th17 cell differentiation
    108532886 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108532886 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532886 (JAK1)
   05203 Viral carcinogenesis
    108532886 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108532886 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108532886 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108532886 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108532886 (JAK1)
   05161 Hepatitis B
    108532886 (JAK1)
   05160 Hepatitis C
    108532886 (JAK1)
   05171 Coronavirus disease - COVID-19
    108532886 (JAK1)
   05164 Influenza A
    108532886 (JAK1)
   05162 Measles
    108532886 (JAK1)
   05168 Herpes simplex virus 1 infection
    108532886 (JAK1)
   05163 Human cytomegalovirus infection
    108532886 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108532886 (JAK1)
   05169 Epstein-Barr virus infection
    108532886 (JAK1)
   05165 Human papillomavirus infection
    108532886 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108532886 (JAK1)
   05140 Leishmaniasis
    108532886 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108532886 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108532886 (JAK1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108532886 (JAK1)
Protein kinases [BR:rbb01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108532886 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 108532886
NCBI-ProteinID: XP_017732678
UniProt: A0A2K6JTR0
LinkDB
Position
Un
AA seq 1154 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYMSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKSKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatatgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctcccctctttgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccgactccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctatgagaaa
aaaaaggttccagatgcaacccctctccttgatgccagctcactggagtatctctttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgaaaacgagtgtctggggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tatggcgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcaaatgacagtggaaacgttctgtactatgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaagtaaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttatttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttctcatgag
gaggccttgtcctttgtgtcactggtagatggctacttccggctcaccgcagacgcccat
cattacctctgcaccgacgtggccccaccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagcctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgttg
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcaacccgtctaccccatgagccagctgagttttgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctggg
accctgatggattacaaggatgatgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagtgatgtccttactacaccctggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaagataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagcgagtgtggtccgttcatcaagctcagtgaccct
ggcatccccattacggtgctgtctaggcaagagtgcattgaacgaatcccatggattgct
cccgagtgtgttgaggactccaagaacctgagcgtggctgctgacaagtggagctttgga
actacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcccttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaag
ccagcaactgaagtggaccccacgcattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcacgagaacattgtgaagtac
aaaggaatctgcacggaagatggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatatgtt
caccgtgacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaactgataaggagtattacaccgtgaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatc
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggccttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system