KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523178Help
Entry
108523178         CDS       T04641                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00590  Arachidonic acid metabolism
rbb01100  Metabolic pathways
rbb04064  NF-kappa B signaling pathway
rbb04370  VEGF signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04668  TNF signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04726  Serotonergic synapse
rbb04913  Ovarian steroidogenesis
rbb04921  Oxytocin signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb05140  Leishmaniasis
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05200  Pathways in cancer
rbb05204  Chemical carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108523178 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108523178 (PTGS2)
   04064 NF-kappa B signaling pathway
    108523178 (PTGS2)
   04668 TNF signaling pathway
    108523178 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108523178 (PTGS2)
   04657 IL-17 signaling pathway
    108523178 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    108523178 (PTGS2)
   04913 Ovarian steroidogenesis
    108523178 (PTGS2)
   04921 Oxytocin signaling pathway
    108523178 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    108523178 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    108523178 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    108523178 (PTGS2)
   05206 MicroRNAs in cancer
    108523178 (PTGS2)
   05204 Chemical carcinogenesis
    108523178 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    108523178 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    108523178 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108523178 (PTGS2)
   05165 Human papillomavirus infection
    108523178 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    108523178 (PTGS2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108523178 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 108523178
NCBI-ProteinID: XP_017719192
UniProt: A0A2K6LI61
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARAVLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNIVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGIAQFVESFTKQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccgtgctgctgtgcgcagtcctggcgctcggccacgcagcaaatcct
tgctgttcctacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccaatat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacattgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgttgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccgactcctttgggtgtgaaaggtaagaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgttcgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaagggctgggccatggggtggacttaaatcatatttat
ggtgaaactctggatagacagcacaaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtgtgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtacagcacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaataccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattgcccagtttgttgaatcattcaccaagcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tacggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccgttctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagtacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagtcaccatcaat
gcaagttcttcccgctccagactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system