KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523321
Entry
108523321         CDS       T04641                                 

Gene name
ELOB, TCEB2
Definition
(RefSeq) elongin B
  KO
K03873  elongin-B
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108523321 (ELOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108523321 (ELOB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108523321 (ELOB)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108523321 (ELOB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108523321 (ELOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108523321 (ELOB)
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108523321 (ELOB)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     108523321 (ELOB)
   ECS complex
     108523321 (ELOB)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108523321 (ELOB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 108523321
NCBI-ProteinID: XP_017719341
UniProt: A0A2K6JZW2
LinkDB
Position
Un
AA seq 153 aa
MCERAWGRGGRAGPAAGGGWRAGGLGFLLTPARRPQDVFLMIRRHKTTIFTDAKESSTVF
ELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTF
EALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtgtgagcgggcgtgggggaggggcggccgggccgggccggcggcggggggcggctgg
cgcgcggggggcctgggcttcttgctcacgccggcccgccgcccccaggacgtgttcctc
atgatccggcgccacaagaccaccatcttcacggacgccaaggaatccagcacggtgttc
gagctgaagcgcatcgtcgagggcatcctcaagcggcctcctgacgagcagcggctgtac
aaggatgaccaactcttggatgatggcaagaccctgggcgagtgtggcttcaccagtcaa
acagcacggccacaggccccagccacagtggggctggccttccgggcagatgacaccttt
gaggccctgtgcatcgagccgttctccagcccacctgagctgcccgatgtgatgaagccc
caggactcgggaagcagtgccaatgaacaagccgtgcagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108531561
Entry
108531561         CDS       T04641                                 

Definition
(RefSeq) transcription elongation factor B polypeptide 2
  KO
K03873  elongin-B
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108531561
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108531561
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108531561
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108531561
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108531561
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108531561
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108531561
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     108531561
   ECS complex
     108531561
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108531561
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 108531561
NCBI-ProteinID: XP_017730541
UniProt: A0A2K6KJ09
LinkDB
Position
Un
AA seq 118 aa
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggaa
tccagcacggtgttcgagctgaagcgcatcgtcgagggcatcctcaagaggcctcctgac
gagcagcggctgtacaaggatgaccaactcttggatgatggcaagaccctgggcgagtgt
ggcttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccgg
gcagatgacacctttgaggccctgtgcatcgagccgttctccagcccacctgagctgccc
gatgtgatgaagccccaggactcgggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system