KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523393
Entry
108523393         CDS       T04641                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor
  KO
K06503  transferrin receptor
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04144  Endocytosis
rbb04145  Phagosome
rbb04216  Ferroptosis
rbb04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108523393 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108523393 (TFRC)
   04145 Phagosome
    108523393 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    108523393 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108523393 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108523393 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108523393 (TFRC)
   04090 CD molecules [BR:rbb04090]
    108523393 (TFRC)
Peptidases and inhibitors [BR:rbb01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   108523393 (TFRC)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108523393 (TFRC)
  Exosomal proteins of colorectal cancer cells
   108523393 (TFRC)
CD molecules [BR:rbb04090]
 Proteins
  108523393 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer
Other DBs
NCBI-GeneID: 108523393
NCBI-ProteinID: XP_017719486
UniProt: A0A2K6MPA5
LinkDB
Position
Un
AA seq 760 aa
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLGVDEEENADNNTKANGTKPK
RCNGNICYGTIAVIIFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPEEGFPAAS
RLYWDDLKRKLSEKLDTTDFTSTIKLLNENSYVPREAGSQKDENLALYIENQLREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGGLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLDSPVNGSIVIVRAGKITFAEKVANAESLNATGVLIYMDRTKFPIVKADLSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAAAEKLFGNMEGDCPADWKTD
STCKMVTSENKSVKLTVSNVLKETKILNIFGVIKGFVEPDHYVIVGAQRDAWGPGAAKSS
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQDVKHPVTGRSLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELVEKIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLLFLRDLNQYRADVKEMGLSLQWLYSARGDFFRATSRLTTDF
RNAEKTDKFVMKKLNDRVMRVEYYFLSPYVSPKESPFRHVFWGSGSHTLSALLENLKLRR
QNNSAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgatggatcaagctagatcagcattctctaacttgtttggtggagaaccattgtcatat
acccggttcagcctggctcggcaagtagatggcgataacagtcatgtggagatgaaactt
ggtgtagatgaagaagaaaatgctgacaataacacaaaggccaatggcacaaaaccaaaa
aggtgtaatggaaatatctgctatgggactattgccgtgatcatctttttcttgattggg
tttatgattggctacttgggctattgtaaaggggtagaaccaaaaactgagtgtgagcga
ctggcaggaaccgagtctccagtgagggaggagccggaagagggcttccctgcagcatct
cgcttatactgggatgacctgaagagaaagttgtcagagaaactggacaccacagacttc
accagcaccatcaagctgctgaatgaaaattcctatgttcctcgtgaggctggatctcaa
aaagatgaaaatcttgcattgtatattgaaaatcaattgcgtgaatttaaactcagcaag
gtctggcgtgatcagcattttgttaagattcaggtcaaagacagtgctcaaaactcggtg
atcatagttgataagaatggtggacttgtttacctggtggagaatcctgggggttatgtg
gcatatagtaaggctgcaacagttactggtaaactggtccatgctaattttggtactaaa
aaagactttgaggatttagactctcctgtgaatggatctatagtgattgtcagagcagga
aaaatcacctttgcagaaaaggttgcaaatgctgaaagcttaaatgcaactggtgtcttg
atatatatggaccggactaaatttcccattgttaaggcagacctttcattcttcggccat
gctcatctgggaacaggtgacccttacacacctggattcccttccttcaatcacactcag
tttccaccatctcagtcgtcaggattgcctaatatacctgtccaaacgatctccagagct
gctgccgaaaagctgtttggaaatatggagggagactgtcccgctgactggaaaacagac
tctacatgtaagatggtaacctcggaaaacaagagtgtgaagctcacggtgagcaatgtg
ctgaaagagacaaaaattcttaacatctttggagttattaaaggctttgtagaaccagat
cactatgttatagttggggcccagagagatgcgtggggccccggagctgcaaaatccagt
gtagggacagctctcctgttgaaacttgcccagatgttctcagatatggtcttaaaagat
gggtttcagcccagcaggagcattatctttgccagttggagtgctggagactttggatcg
gttggtgccactgaatggctagagggatacctttcatccttgcatttaaaggctttcact
tatattaatctggataaagcggtgcttggtaccagcaacttcaaggtttctgccagccca
ttgttgtatacgcttattgagaaaacaatgcaagatgtgaaacatccagttactgggcga
tctctctatcaggacagcaactgggccagcaaagttgagaagctcactttagacaatgct
gctttccctttccttgcgtattctggaatcccagcagtttctttctgtttttgtgaggac
acagattatccttacttgggcactaccatggacacctataaggaactggtggagaagatt
cctgagctgaacaaagtggcacgagcagcggcagaagtagctggtcagttcgtgattaaa
ctgacccatgatgttgaattgaacctggactatgagaggtacaacagccagctgcttttg
tttttgagggatctgaaccagtacagagcagatgtaaaggaaatgggcctgagtttgcag
tggctgtattctgctcgtggagactttttccgcgctacttccagactaacaacagatttc
aggaatgctgagaaaacggacaagtttgtcatgaagaagctcaatgatcgtgtcatgaga
gtggagtattacttcctctcaccctatgtgtctccaaaagagtctcctttccgacatgtc
ttctggggctccggctctcacacactgtcagctttactggagaacttgaaactgcgtaga
caaaataacagtgcttttaatgaaacgctgttcagaaaccagttggctctcgctacttgg
actattcagggagctgcaaatgccctctctggtgacgtttgggacattgacaatgagttt
taa

DBGET integrated database retrieval system