KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523439
Entry
108523439         CDS       T04641                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108523439
   04215 Apoptosis - multiple species
    108523439
   04115 p53 signaling pathway
    108523439
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108523439
  09162 Cancer: specific types
   05210 Colorectal cancer
    108523439
   05222 Small cell lung cancer
    108523439
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108523439
   05012 Parkinson disease
    108523439
   05014 Amyotrophic lateral sclerosis
    108523439
   05016 Huntington disease
    108523439
   05017 Spinocerebellar ataxia
    108523439
   05020 Prion disease
    108523439
   05022 Pathways of neurodegeneration - multiple diseases
    108523439
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108523439
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108523439
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108523439
   05134 Legionellosis
    108523439
   05152 Tuberculosis
    108523439
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108523439
   05161 Hepatitis B
    108523439
   05160 Hepatitis C
    108523439
   05164 Influenza A
    108523439
   05162 Measles
    108523439
   05168 Herpes simplex virus 1 infection
    108523439
   05163 Human cytomegalovirus infection
    108523439
   05167 Kaposi sarcoma-associated herpesvirus infection
    108523439
   05169 Epstein-Barr virus infection
    108523439
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108523439
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108523439
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108523439
NCBI-ProteinID: XP_017719552
UniProt: A0A2K6JWZ3
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTVANKNKGITW
GEDTLMEYLENPKKYIPGRKMVFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagtcgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaagaaaa
atggtctttgttggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524009
Entry
108524009         CDS       T04641                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108524009
   04215 Apoptosis - multiple species
    108524009
   04115 p53 signaling pathway
    108524009
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524009
  09162 Cancer: specific types
   05210 Colorectal cancer
    108524009
   05222 Small cell lung cancer
    108524009
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108524009
   05012 Parkinson disease
    108524009
   05014 Amyotrophic lateral sclerosis
    108524009
   05016 Huntington disease
    108524009
   05017 Spinocerebellar ataxia
    108524009
   05020 Prion disease
    108524009
   05022 Pathways of neurodegeneration - multiple diseases
    108524009
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108524009
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108524009
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108524009
   05134 Legionellosis
    108524009
   05152 Tuberculosis
    108524009
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108524009
   05161 Hepatitis B
    108524009
   05160 Hepatitis C
    108524009
   05164 Influenza A
    108524009
   05162 Measles
    108524009
   05168 Herpes simplex virus 1 infection
    108524009
   05163 Human cytomegalovirus infection
    108524009
   05167 Kaposi sarcoma-associated herpesvirus infection
    108524009
   05169 Epstein-Barr virus infection
    108524009
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108524009
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108524009
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108524009
NCBI-ProteinID: XP_017720283
UniProt: A0A2K6JYN8
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggctcctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524923
Entry
108524923         CDS       T04641                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108524923
   04215 Apoptosis - multiple species
    108524923
   04115 p53 signaling pathway
    108524923
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524923
  09162 Cancer: specific types
   05210 Colorectal cancer
    108524923
   05222 Small cell lung cancer
    108524923
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108524923
   05012 Parkinson disease
    108524923
   05014 Amyotrophic lateral sclerosis
    108524923
   05016 Huntington disease
    108524923
   05017 Spinocerebellar ataxia
    108524923
   05020 Prion disease
    108524923
   05022 Pathways of neurodegeneration - multiple diseases
    108524923
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108524923
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108524923
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108524923
   05134 Legionellosis
    108524923
   05152 Tuberculosis
    108524923
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108524923
   05161 Hepatitis B
    108524923
   05160 Hepatitis C
    108524923
   05164 Influenza A
    108524923
   05162 Measles
    108524923
   05168 Herpes simplex virus 1 infection
    108524923
   05163 Human cytomegalovirus infection
    108524923
   05167 Kaposi sarcoma-associated herpesvirus infection
    108524923
   05169 Epstein-Barr virus infection
    108524923
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108524923
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108524923
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108524923
NCBI-ProteinID: XP_017721497
UniProt: A0A2K6JMX4
LinkDB
Position
Un
AA seq 105 aa
MGDVETGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagacaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgttggcattaagaaaaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaaggagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530087
Entry
108530087         CDS       T04641                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108530087
   04215 Apoptosis - multiple species
    108530087
   04115 p53 signaling pathway
    108530087
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530087
  09162 Cancer: specific types
   05210 Colorectal cancer
    108530087
   05222 Small cell lung cancer
    108530087
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108530087
   05012 Parkinson disease
    108530087
   05014 Amyotrophic lateral sclerosis
    108530087
   05016 Huntington disease
    108530087
   05017 Spinocerebellar ataxia
    108530087
   05020 Prion disease
    108530087
   05022 Pathways of neurodegeneration - multiple diseases
    108530087
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108530087
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108530087
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108530087
   05134 Legionellosis
    108530087
   05152 Tuberculosis
    108530087
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108530087
   05161 Hepatitis B
    108530087
   05160 Hepatitis C
    108530087
   05164 Influenza A
    108530087
   05162 Measles
    108530087
   05168 Herpes simplex virus 1 infection
    108530087
   05163 Human cytomegalovirus infection
    108530087
   05167 Kaposi sarcoma-associated herpesvirus infection
    108530087
   05169 Epstein-Barr virus infection
    108530087
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108530087
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108530087
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108530087
NCBI-ProteinID: XP_017728249
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKTFVQKCVQCRTTEKGGKDKTGPNLHDIFGQKMGQAVGFSYTNVNKNKGITW
GEDTLMEYLDNSKKYIPGTKVIFAGIKRKVERADLIAYLKNATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagacttttgttcagaagtgtgtccagtgccgcacc
acggaaaaaggaggcaaggacaagactgggcctaatcttcatgatatctttgggcagaag
atgggtcaggctgttggattctcttacacaaatgtcaataagaacaaaggcatcacttgg
ggagaggacacactaatggagtatttggataattccaagaagtacatccctggaacaaaa
gtgatctttgctggcattaagaggaaggtagaaagggcagacttgatagcttatctcaaa
aatgctactaatgagtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532915
Entry
108532915         CDS       T04641                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108532915
   04215 Apoptosis - multiple species
    108532915
   04115 p53 signaling pathway
    108532915
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532915
  09162 Cancer: specific types
   05210 Colorectal cancer
    108532915
   05222 Small cell lung cancer
    108532915
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108532915
   05012 Parkinson disease
    108532915
   05014 Amyotrophic lateral sclerosis
    108532915
   05016 Huntington disease
    108532915
   05017 Spinocerebellar ataxia
    108532915
   05020 Prion disease
    108532915
   05022 Pathways of neurodegeneration - multiple diseases
    108532915
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108532915
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108532915
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108532915
   05134 Legionellosis
    108532915
   05152 Tuberculosis
    108532915
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108532915
   05161 Hepatitis B
    108532915
   05160 Hepatitis C
    108532915
   05164 Influenza A
    108532915
   05162 Measles
    108532915
   05168 Herpes simplex virus 1 infection
    108532915
   05163 Human cytomegalovirus infection
    108532915
   05167 Kaposi sarcoma-associated herpesvirus infection
    108532915
   05169 Epstein-Barr virus infection
    108532915
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108532915
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108532915
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108532915
NCBI-ProteinID: XP_017732717
UniProt: A0A2K6JYN8
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533297
Entry
108533297         CDS       T04641                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108533297
   04215 Apoptosis - multiple species
    108533297
   04115 p53 signaling pathway
    108533297
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108533297
  09162 Cancer: specific types
   05210 Colorectal cancer
    108533297
   05222 Small cell lung cancer
    108533297
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108533297
   05012 Parkinson disease
    108533297
   05014 Amyotrophic lateral sclerosis
    108533297
   05016 Huntington disease
    108533297
   05017 Spinocerebellar ataxia
    108533297
   05020 Prion disease
    108533297
   05022 Pathways of neurodegeneration - multiple diseases
    108533297
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108533297
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108533297
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108533297
   05134 Legionellosis
    108533297
   05152 Tuberculosis
    108533297
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108533297
   05161 Hepatitis B
    108533297
   05160 Hepatitis C
    108533297
   05164 Influenza A
    108533297
   05162 Measles
    108533297
   05168 Herpes simplex virus 1 infection
    108533297
   05163 Human cytomegalovirus infection
    108533297
   05167 Kaposi sarcoma-associated herpesvirus infection
    108533297
   05169 Epstein-Barr virus infection
    108533297
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108533297
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108533297
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108533297
NCBI-ProteinID: XP_017733357
UniProt: A0A2K6JWH7
LinkDB
Position
Un
AA seq 104 aa
MGNVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGQKPGQAVGFSYTDANKNKCITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKVEKADLTAYLKKATN
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtaatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgtcacacc
gtggaaaagggaggcaagcacaagactgggcctaatctccatggtctcttcgggcagaag
ccaggtcaggccgttggattctcttacacagatgccaataagaacaaatgcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgccggcattaaaaagaaggtagaaaaggccgacttgacagcttatctcaaa
aaagctactaattag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535521
Entry
108535521         CDS       T04641                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108535521
   04215 Apoptosis - multiple species
    108535521
   04115 p53 signaling pathway
    108535521
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535521
  09162 Cancer: specific types
   05210 Colorectal cancer
    108535521
   05222 Small cell lung cancer
    108535521
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108535521
   05012 Parkinson disease
    108535521
   05014 Amyotrophic lateral sclerosis
    108535521
   05016 Huntington disease
    108535521
   05017 Spinocerebellar ataxia
    108535521
   05020 Prion disease
    108535521
   05022 Pathways of neurodegeneration - multiple diseases
    108535521
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108535521
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108535521
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108535521
   05134 Legionellosis
    108535521
   05152 Tuberculosis
    108535521
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108535521
   05161 Hepatitis B
    108535521
   05160 Hepatitis C
    108535521
   05164 Influenza A
    108535521
   05162 Measles
    108535521
   05168 Herpes simplex virus 1 infection
    108535521
   05163 Human cytomegalovirus infection
    108535521
   05167 Kaposi sarcoma-associated herpesvirus infection
    108535521
   05169 Epstein-Barr virus infection
    108535521
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108535521
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108535521
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108535521
NCBI-ProteinID: XP_017737036
UniProt: A0A2K6JYN8
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggaatatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536287
Entry
108536287         CDS       T04641                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108536287
   04215 Apoptosis - multiple species
    108536287
   04115 p53 signaling pathway
    108536287
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108536287
  09162 Cancer: specific types
   05210 Colorectal cancer
    108536287
   05222 Small cell lung cancer
    108536287
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108536287
   05012 Parkinson disease
    108536287
   05014 Amyotrophic lateral sclerosis
    108536287
   05016 Huntington disease
    108536287
   05017 Spinocerebellar ataxia
    108536287
   05020 Prion disease
    108536287
   05022 Pathways of neurodegeneration - multiple diseases
    108536287
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108536287
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108536287
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108536287
   05134 Legionellosis
    108536287
   05152 Tuberculosis
    108536287
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108536287
   05161 Hepatitis B
    108536287
   05160 Hepatitis C
    108536287
   05164 Influenza A
    108536287
   05162 Measles
    108536287
   05168 Herpes simplex virus 1 infection
    108536287
   05163 Human cytomegalovirus infection
    108536287
   05167 Kaposi sarcoma-associated herpesvirus infection
    108536287
   05169 Epstein-Barr virus infection
    108536287
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108536287
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108536287
SSDB
Motif
Pfam: Cytochrom_C Cytochrom_C550
Other DBs
NCBI-GeneID: 108536287
NCBI-ProteinID: XP_017738411
LinkDB
Position
Un
AA seq 104 aa
MGDVEKGKRIFIQKCAQFHTVEKGGEHMAGSNLCGLFAGKIDQAIGFSYTEAHKNKSITW
GENTLMEYLENPKKHIRGVKMIFTDMKNKAERAALIVHLKKSYQ
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagagaatttttattcagaagtgtgcccagtttcacact
gttgaaaagggaggcgaacacatggctgggtcaaatctctgtggtctctttgcagggaag
atagatcaggccattggattctcttatacagaggcccataagaacaaaagcatcacctgg
ggagagaatacactcatggagtatttagagaatcccaagaagcacatccgtggcgtaaaa
atgatcttcacagacatgaagaacaaggcagaaagggcagccttgatagttcatctcaaa
aaaagctaccaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538827
Entry
108538827         CDS       T04641                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05222  Small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108538827
   04215 Apoptosis - multiple species
    108538827
   04115 p53 signaling pathway
    108538827
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538827
  09162 Cancer: specific types
   05210 Colorectal cancer
    108538827
   05222 Small cell lung cancer
    108538827
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108538827
   05012 Parkinson disease
    108538827
   05014 Amyotrophic lateral sclerosis
    108538827
   05016 Huntington disease
    108538827
   05017 Spinocerebellar ataxia
    108538827
   05020 Prion disease
    108538827
   05022 Pathways of neurodegeneration - multiple diseases
    108538827
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108538827
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108538827
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108538827
   05134 Legionellosis
    108538827
   05152 Tuberculosis
    108538827
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108538827
   05161 Hepatitis B
    108538827
   05160 Hepatitis C
    108538827
   05164 Influenza A
    108538827
   05162 Measles
    108538827
   05168 Herpes simplex virus 1 infection
    108538827
   05163 Human cytomegalovirus infection
    108538827
   05167 Kaposi sarcoma-associated herpesvirus infection
    108538827
   05169 Epstein-Barr virus infection
    108538827
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108538827
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108538827
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 108538827
NCBI-ProteinID: XP_017742600
LinkDB
Position
Un
AA seq 102 aa
MGDVEKGKKIFVQKCAQCHAMEKGGKHKTGPNLFGRKTGQAVGFSHTDASKNKGITWGED
TLMEYLKNPKKYIPGTKMIFAGIKKEAERADLIAYLKKATNE
NT seq 309 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatgcc
atggaaaagggaggcaagcataagactgggcctaatctcttcgggcggaagacaggtcag
gccgttggattctctcacacagatgccagtaagaacaaaggcatcacctggggagaggat
acactgatggagtatttgaagaatcccaagaagtacatccctggaacaaaaatgatcttt
gccggcattaagaaggaggcagaaagggcagacttgatagcttatctcaaaaaagctact
aatgagtaa

DBGET integrated database retrieval system