KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523449
Entry
108523449         CDS       T04641                                 

Gene name
CXCL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04061  Viral protein interaction with cytokine and cytokine receptor
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04218  Cellular senescence
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05144  Malaria
rbb05146  Amoebiasis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05219  Bladder cancer
rbb05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108523449 (CXCL8)
   04072 Phospholipase D signaling pathway
    108523449 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108523449 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108523449 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108523449 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108523449 (CXCL8)
   04621 NOD-like receptor signaling pathway
    108523449 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    108523449 (CXCL8)
   04657 IL-17 signaling pathway
    108523449 (CXCL8)
   04062 Chemokine signaling pathway
    108523449 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108523449 (CXCL8)
   05202 Transcriptional misregulation in cancer
    108523449 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    108523449 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108523449 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108523449 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108523449 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108523449 (CXCL8)
   05135 Yersinia infection
    108523449 (CXCL8)
   05133 Pertussis
    108523449 (CXCL8)
   05134 Legionellosis
    108523449 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108523449 (CXCL8)
   05171 Coronavirus disease - COVID-19
    108523449 (CXCL8)
   05164 Influenza A
    108523449 (CXCL8)
   05163 Human cytomegalovirus infection
    108523449 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108523449 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108523449 (CXCL8)
   05144 Malaria
    108523449 (CXCL8)
   05142 Chagas disease
    108523449 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108523449 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108523449 (CXCL8)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Chemokines
   108523449 (CXCL8)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Chemokines
   108523449 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 108523449
NCBI-ProteinID: XP_017719558
UniProt: A0A2K6K5N8
LinkDB
Position
Un
AA seq 101 aa
MTSKLAVALLAAFLLSAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKEPWVQRVVDKFVKRAENQNS
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggcggtggctctcttggcagccttcctgctttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttaggtgtcagtgcataaagacgtac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaatacagaaattattgtaaaactttccgatggaagagagctctgtctggacccc
aaggagccatgggtgcagagggttgtggacaagtttgtgaagagggctgagaatcaaaat
tcataa

DBGET integrated database retrieval system