KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523624
Entry
108523624         CDS       T04641                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04071  Sphingolipid signaling pathway
rbb04115  p53 signaling pathway
rbb04141  Protein processing in endoplasmic reticulum
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04722  Neurotrophin signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108523624 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    108523624 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108523624 (BAX)
   04215 Apoptosis - multiple species
    108523624 (BAX)
   04217 Necroptosis
    108523624 (BAX)
   04115 p53 signaling pathway
    108523624 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108523624 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    108523624 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108523624 (BAX)
   05202 Transcriptional misregulation in cancer
    108523624 (BAX)
   05203 Viral carcinogenesis
    108523624 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108523624 (BAX)
   05212 Pancreatic cancer
    108523624 (BAX)
   05225 Hepatocellular carcinoma
    108523624 (BAX)
   05226 Gastric cancer
    108523624 (BAX)
   05214 Glioma
    108523624 (BAX)
   05216 Thyroid cancer
    108523624 (BAX)
   05220 Chronic myeloid leukemia
    108523624 (BAX)
   05217 Basal cell carcinoma
    108523624 (BAX)
   05218 Melanoma
    108523624 (BAX)
   05213 Endometrial cancer
    108523624 (BAX)
   05224 Breast cancer
    108523624 (BAX)
   05222 Small cell lung cancer
    108523624 (BAX)
   05223 Non-small cell lung cancer
    108523624 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108523624 (BAX)
   05014 Amyotrophic lateral sclerosis
    108523624 (BAX)
   05016 Huntington disease
    108523624 (BAX)
   05020 Prion disease
    108523624 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    108523624 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108523624 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108523624 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108523624 (BAX)
   05152 Tuberculosis
    108523624 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108523624 (BAX)
   05170 Human immunodeficiency virus 1 infection
    108523624 (BAX)
   05161 Hepatitis B
    108523624 (BAX)
   05160 Hepatitis C
    108523624 (BAX)
   05164 Influenza A
    108523624 (BAX)
   05162 Measles
    108523624 (BAX)
   05168 Herpes simplex virus 1 infection
    108523624 (BAX)
   05163 Human cytomegalovirus infection
    108523624 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108523624 (BAX)
   05169 Epstein-Barr virus infection
    108523624 (BAX)
   05165 Human papillomavirus infection
    108523624 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108523624 (BAX)
   01524 Platinum drug resistance
    108523624 (BAX)
   01522 Endocrine resistance
    108523624 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108523624 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbb02000]
    108523624 (BAX)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    108523624 (BAX)
Transporters [BR:rbb02000]
 Other transporters
  Pores ion channels [TC:1]
   108523624 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108523624
NCBI-ProteinID: XP_017719795
UniProt: A0A2K6MIJ2
LinkDB
Position
Un
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gagacacccgagctggccctggacccagtgcctcaggatgcgtccaccaagaggctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgtgttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgaactgatcagaaccatcatgggctggaca
ctggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcttggtggctggagta
ctcaccgcctccctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system