KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524016
Entry
108524016         CDS       T04641                                 

Gene name
MARCKSL1
Definition
(RefSeq) MARCKS like 1
  KO
K13536  MARCKS-related protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    108524016 (MARCKSL1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108524016 (MARCKSL1)
SSDB
Motif
Pfam: MARCKS
Other DBs
NCBI-GeneID: 108524016
NCBI-ProteinID: XP_017720293
LinkDB
Position
Un
AA seq 195 aa
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGA
TGDAIEPAPPSQGAEAKGEVPPKEXPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASS
PTEEEQEQGEIGACSDEGTVQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPS
GPESGPTPASAEQNE
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggcagccagagctccaaggctccccggggcgacgtgaccgccgaggaggcagcaggc
gcttcccccgcgaaggccaacggccaggagaatggccacgtgaaaagcaatggagactta
tcccccaagggtgaaggggagtcgccccccgtgaacggaacagatgaggcagccggggcc
actggcgatgccatcgagccagcaccccctagccagggtgctgaggccaagggggaggtc
ccccccaaggagnaccccaagaagaagaagaaattctctttcaagaagcctttcaaattg
agcggcctgtccttcaagagaaatcggaaggagggtgggggtgattcttctgcctcctca
cccacagaggaagagcaggagcagggggagatcggtgcctgcagcgacgagggcactgtc
caggaagggaaggccgcagccacccctgagagccaggaaccccaggccaagggggcagag
gctagtgcggcctcagaagaagaggcagggccccaggctacagagccatccactccctcg
gggccggagagtggccctacaccagccagcgctgagcagaatgagtag

DBGET integrated database retrieval system