KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524131
Entry
108524131         CDS       T04641                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01524  Platinum drug resistance
rbb04014  Ras signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04115  p53 signaling pathway
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04621  NOD-like receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05145  Toxoplasmosis
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05168  Herpes simplex virus 1 infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108524131 (BCL2L1)
   04630 JAK-STAT signaling pathway
    108524131 (BCL2L1)
   04064 NF-kappa B signaling pathway
    108524131 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    108524131 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108524131 (BCL2L1)
   04137 Mitophagy - animal
    108524131 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    108524131 (BCL2L1)
   04215 Apoptosis - multiple species
    108524131 (BCL2L1)
   04115 p53 signaling pathway
    108524131 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108524131 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524131 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    108524131 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108524131 (BCL2L1)
   05225 Hepatocellular carcinoma
    108524131 (BCL2L1)
   05220 Chronic myeloid leukemia
    108524131 (BCL2L1)
   05222 Small cell lung cancer
    108524131 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108524131 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    108524131 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    108524131 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108524131 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    108524131 (BCL2L1)
   05162 Measles
    108524131 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    108524131 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108524131 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108524131 (BCL2L1)
   01524 Platinum drug resistance
    108524131 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108524131 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108524131 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbb02000]
    108524131 (BCL2L1)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108524131 (BCL2L1)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108524131 (BCL2L1)
Transporters [BR:rbb02000]
 Other transporters
  Pores ion channels [TC:1]
   108524131 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 108524131
NCBI-ProteinID: XP_017720533
LinkDB
Position
Un
AA seq 251 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWTMLLRKLFVSPAHAHVQEFLPGRWFPNFSCPSESPGRTLLWNSMGTMQQPRA
ERARSASTAGS
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttatctgaatgaccacctagagcct
tggatccaggagaacggcggctggacaatgctgttaagaaaactgtttgtgtctcctgca
catgcacatgttcaagagtttctcccaggccggtggttcccaaactttagctgcccatca
gaatcacctggaaggacacttttgtggaactctatgggaacaatgcagcagccgagagcc
gaaagggccaggagcgcttcaaccgctggttcctga

DBGET integrated database retrieval system