KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524262
Entry
108524262         CDS       T04641                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain containing 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04110  Cell cycle
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108524262 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524262 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    108524262 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108524262 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108524262 (ZBTB17)
   04121 Ubiquitin system [BR:rbb04121]
    108524262 (ZBTB17)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    108524262 (ZBTB17)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     108524262 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 zinc_ribbon_15 Zn-ribbon_8 zf-C2HC_2 zf-BED zf_UBZ zf-C2HE zf-Di19 Packaging_FI XPA_N HypA DUF3268
Other DBs
NCBI-GeneID: 108524262
NCBI-ProteinID: XP_017720754
UniProt: A0A2K6KSZ2
LinkDB
Position
Un
AA seq 803 aa
MAAMDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQK
DVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEP
ATSPGGNAEALATEGGDKTAKEEKAATSMLSRLEQAGRSAPTGPSRDLKEERGGQAQSTA
SGAEQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEPEEQ
EEEGAGPAEVKEEGPQLENGEAPEENENEESAGTDSGQELGAEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggcagccatggactttccccagcacagccagcacgtcttggaacagctgaaccagcag
cggcagctggggcttctctgtgactgcacctttgtggtggacggtgttcactttaaggct
cataaagcagtgctggcggcctgcagcgagtacttcaaaatgctctttgtggaccagaag
gacgtggtgcacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatg
tacacggccaagctgagcctgagccctgagaacgtggatgatgtgctggccgtggccacc
ttcctccaaatgcaggacatcatcacagcctgccatgccctcaagtcacttgccgagccg
gctaccagccctgggggaaatgcagaggccttggccacagaaggaggggacaagacagct
aaagaggagaaggcggccaccagcatgctgagcaggctggagcaggcaggacgcagcgca
cccacaggccccagcagggacctcaaggaggagcgtggcggtcaggcccagagcacagcc
agcggtgcagagcagacagagaaagccgatgcgccccgggagccgccgcctgtggagctc
aagccagaccccactagtggcatggctgccgcagaagctgaggctgctttgtccgagagc
tcggagcaagaaatggaggtggagcccgcccggaaaggggaagaggagccagaggagcaa
gaggaggagggcgcagggccagctgaggtcaaggaggagggtccccagctggagaacgga
gaggcccccgaggagaacgagaacgaggagtcagcgggcacagactcggggcaggagctc
ggcgccgaggcccggggcctgcgctcaggcacctacggtgatcgcacggagtccaaggcc
tacggctccgtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaac
ttcaagcggcacatccgcatccacacgggggagaagcccttctcgtgccgtgagtgcagc
aaggccttttccgacccggcggcctgcaaggcccatgagaagacgcacagccctctgaag
ccctacggctgcgaggagtgtgggaagagctaccgcctcatcagcctgctcaacctgcac
aagaagcggcactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcacc
acctcgggcaacctcaagcgccaccagctggtgcacagcggcgagaagccctaccagtgc
gactactgcgggcgctccttctccgaccccacttccaagatgcgccacctggagacccac
gacacggacaaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaac
ctgaaggcccacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtggg
aagcagttcaccacctcagggaacctgaagcggcaccttcggatccacagcggggagaag
ccctatgtgtgtatccactgccagcgacagtttgcagaccccggcgctctgcagcggcat
gtccgcattcacacgggtgagaagccgtgccagtgtgtgatgtgcggtaaggccttcacc
caggccagctccctcatcgcccacgtacgccagcacacgggggagaagccctacgtctgc
gagcgctgcggcaagagatttgtccagtccagccagctggccaatcatattcgccaccac
gacaacatccgtccacacaagtgcagcgtgtgcagcaaggccttcgtgaatgtgggggac
ctctccaagcacatcatcatccacactggagagaagccttacctgtgtgataagtgcggg
cgtggcttcaaccgggtagacaacctgcgctcccacgtgaagacggtgcaccagggcaag
gcaggcatcaagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggat
gacatggtcacgctggccactgaggcactggcagcgacagccgtcactcagctcacagtg
gtgccggtgggagctgcagtgacagccgatgagacggaagtcctgaaggccgagatcagc
aaagctgtgaagcaagtgcaggaggaagaccccaacactcacatcctctatgcctgtgac
tcctgtggggacaagtttctggatgccaacagcctggctcagcacgtgcgaatccacaca
gcccaagcactggtcatgttccagacagacgcggacttctaccagcagtatgggccaggt
ggcacgtggcctgccgggcaggtgctgcaggctggggagctggtcttccgccctcgggat
ggggctgagggccagcccgcactggcagagacctcccctacagctcctgaatgtccgccg
cctgccgagtga

DBGET integrated database retrieval system