KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524269
Entry
108524269         CDS       T04641                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04370  VEGF signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05215  Prostate cancer
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108524269 (CASP9)
   04151 PI3K-Akt signaling pathway
    108524269 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108524269 (CASP9)
   04215 Apoptosis - multiple species
    108524269 (CASP9)
   04115 p53 signaling pathway
    108524269 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108524269 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524269 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108524269 (CASP9)
   05212 Pancreatic cancer
    108524269 (CASP9)
   05215 Prostate cancer
    108524269 (CASP9)
   05213 Endometrial cancer
    108524269 (CASP9)
   05222 Small cell lung cancer
    108524269 (CASP9)
   05223 Non-small cell lung cancer
    108524269 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108524269 (CASP9)
   05012 Parkinson disease
    108524269 (CASP9)
   05014 Amyotrophic lateral sclerosis
    108524269 (CASP9)
   05016 Huntington disease
    108524269 (CASP9)
   05020 Prion disease
    108524269 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    108524269 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108524269 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108524269 (CASP9)
   05152 Tuberculosis
    108524269 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108524269 (CASP9)
   05161 Hepatitis B
    108524269 (CASP9)
   05160 Hepatitis C
    108524269 (CASP9)
   05164 Influenza A
    108524269 (CASP9)
   05162 Measles
    108524269 (CASP9)
   05168 Herpes simplex virus 1 infection
    108524269 (CASP9)
   05163 Human cytomegalovirus infection
    108524269 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108524269 (CASP9)
   05169 Epstein-Barr virus infection
    108524269 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108524269 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108524269 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108524269 (CASP9)
   01002 Peptidases and inhibitors [BR:rbb01002]
    108524269 (CASP9)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     108524269 (CASP9)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108524269 (CASP9)
Peptidases and inhibitors [BR:rbb01002]
 Cysteine peptidases
  Family C14: caspase family
   108524269 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 MM_CoA_mutase
Other DBs
NCBI-GeneID: 108524269
NCBI-ProteinID: XP_017720778
LinkDB
Position
Un
AA seq 333 aa
MLASFLRTNRQAVQLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGAPE
SLRGNADLAYILSMEPCGHCLIINNVNFCRESGLSTRTGSSIDCEKLQRRFSLLHFMVEV
KHDLTAKEMVLALLELARRDHSALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVERI
VNIFNGTSCPSLGGKPKLFFIQACGGDQKDHGFEVASTPPEDVSSGSNPEPDATPFQDDL
RTFDQLDAVSSLPTPSDIFVSYSTFPGFVSLRDPKSGSWYVETLDDIFEQWAHSEDLQSL
LLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgttggcttcattcctgcgaactaacaggcaagcagtacagttgtcgaagccaacccta
gaaaaccttaccccagtggtgctcagaccagagattcgcaaaccagaagttctcagaccg
gaaacacccagaccagtggacattggttctggaggattcggtgacgtcggtgctcctgag
agtttgaggggaaatgcagatttggcttacatcctgagcatggagccctgtggccactgc
ctcattatcaacaatgtgaacttctgccgtgagtctgggctcagcacccgcactggctcc
agcatcgactgtgagaagttgcagcgccgcttctccttgctgcatttcatggtggaggtg
aagcacgacctgactgccaaggaaatggtgctagctttgctggagctggcacggcgggac
cacagtgctctggactgctgtgtggtggtcattctctctcacggctgtcaggccagccac
ctgcagttcccaggggctgtctatggcacagatggatgccctgtgtcggtcgagaggatt
gtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaagctctttttc
atccaggcctgtggtggggatcagaaagaccatgggtttgaggtggcctccaccccccct
gaagacgtgtcctctggcagtaaccccgagccagacgccaccccgttccaggacgatttg
aggaccttcgaccagctggacgctgtatctagtttgcccacacccagcgacatctttgtg
tcctactctactttcccgggttttgtctccttgagggaccccaagagtggctcctggtac
gttgagaccctggacgacatctttgagcagtgggctcactctgaagacctgcagtccctc
ctgctcagggtcgctaatgctgtttcggtgaaagggatttataaacagatgcctggttgc
tttaatttcctccggaaaaaacttttctttaaaacatcataa

DBGET integrated database retrieval system