KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524397
Entry
108524397         CDS       T04641                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04530  Tight junction
rbb04660  T cell receptor signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108524397 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108524397 (CDK4)
   04115 p53 signaling pathway
    108524397 (CDK4)
   04218 Cellular senescence
    108524397 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108524397 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    108524397 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524397 (CDK4)
   05203 Viral carcinogenesis
    108524397 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108524397 (CDK4)
   05225 Hepatocellular carcinoma
    108524397 (CDK4)
   05214 Glioma
    108524397 (CDK4)
   05220 Chronic myeloid leukemia
    108524397 (CDK4)
   05218 Melanoma
    108524397 (CDK4)
   05219 Bladder cancer
    108524397 (CDK4)
   05224 Breast cancer
    108524397 (CDK4)
   05222 Small cell lung cancer
    108524397 (CDK4)
   05223 Non-small cell lung cancer
    108524397 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108524397 (CDK4)
   04934 Cushing syndrome
    108524397 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108524397 (CDK4)
   05160 Hepatitis C
    108524397 (CDK4)
   05164 Influenza A
    108524397 (CDK4)
   05162 Measles
    108524397 (CDK4)
   05163 Human cytomegalovirus infection
    108524397 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108524397 (CDK4)
   05169 Epstein-Barr virus infection
    108524397 (CDK4)
   05165 Human papillomavirus infection
    108524397 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108524397 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108524397 (CDK4)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     108524397 (CDK4)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   108524397 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 108524397
NCBI-ProteinID: XP_017720935
UniProt: A0A2K6L6N2
LinkDB
Position
Un
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg
aggcgactggaggcttttgaacatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta
aggacgtatctggacaaggcacccccaccaggcttgccagccgagaccatcaaggatttg
atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacgctctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtacagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528490
Entry
108528490         CDS       T04641                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108528490 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108528490 (CDK6)
   04115 p53 signaling pathway
    108528490 (CDK6)
   04218 Cellular senescence
    108528490 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528490 (CDK6)
   05206 MicroRNAs in cancer
    108528490 (CDK6)
   05203 Viral carcinogenesis
    108528490 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108528490 (CDK6)
   05225 Hepatocellular carcinoma
    108528490 (CDK6)
   05214 Glioma
    108528490 (CDK6)
   05220 Chronic myeloid leukemia
    108528490 (CDK6)
   05218 Melanoma
    108528490 (CDK6)
   05224 Breast cancer
    108528490 (CDK6)
   05222 Small cell lung cancer
    108528490 (CDK6)
   05223 Non-small cell lung cancer
    108528490 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108528490 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108528490 (CDK6)
   05164 Influenza A
    108528490 (CDK6)
   05162 Measles
    108528490 (CDK6)
   05163 Human cytomegalovirus infection
    108528490 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108528490 (CDK6)
   05169 Epstein-Barr virus infection
    108528490 (CDK6)
   05165 Human papillomavirus infection
    108528490 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108528490 (CDK6)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     108528490 (CDK6)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   108528490 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 108528490
NCBI-ProteinID: XP_017725792
UniProt: A0A2K6N2K9
LinkDB
Position
Un
AA seq 326 aa
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgtgccgcgctgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacttgaagaacggaggccgtttcgtg
gcgttgaagcgcgtgcgggtgcagacgggcgaggagggcatgccgctctctaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaactttagtgtttgaacat
gttgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattcacaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctcgctgacttcggccttgcccgcatctatagtttccagatggctcttacctcagtggtc
gtcacactgtggtacagagctcccgaagtcttgctccagtccagctacgccacccccgtg
gatctatggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtcgatcaactaggaaaaatcttggacgtaattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcattcaaaatctgcccaa
ccaattgagaagtttgtaacagatatcgatgaactaggcaaagatctacttctgaagtgt
ttgacatttaacccagccaaaagaatatcagcctacagtgccctgtctcacccatacttc
caggacctggagaggtgcaaagaaaacctggattcccacctgccgcccagccagaacacc
tcggagctgaatacagcctga

DBGET integrated database retrieval system