KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524582
Entry
108524582         CDS       T04641                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04915  Estrogen signaling pathway
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108524582 (TGFA)
   04012 ErbB signaling pathway
    108524582 (TGFA)
   04014 Ras signaling pathway
    108524582 (TGFA)
   04151 PI3K-Akt signaling pathway
    108524582 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108524582 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108524582 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108524582 (TGFA)
   05212 Pancreatic cancer
    108524582 (TGFA)
   05225 Hepatocellular carcinoma
    108524582 (TGFA)
   05214 Glioma
    108524582 (TGFA)
   05211 Renal cell carcinoma
    108524582 (TGFA)
   05215 Prostate cancer
    108524582 (TGFA)
   05223 Non-small cell lung cancer
    108524582 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108524582 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154 Lysis_col
Other DBs
NCBI-GeneID: 108524582
NCBI-ProteinID: XP_017721160
UniProt: A0A2K6KT83
LinkDB
Position
Un
AA seq 166 aa
MFTIRRGALNLLSELLSFGGIVLAACQALENSTSLLSADPPVAAAVVSHFNDCPDSHTQF
CFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVL
IITCVLIHCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETVV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgttcacgatccgcagaggcgccctcaatctcctttcagagctcttgagctttgggggt
attgtgttggccgcgtgccaggccttggagaacagcacgtccctgctgagtgcagacccg
cccgtggccgcagcagtggtgtcccattttaatgactgcccagattcccacactcagttc
tgcttccatggaacctgcaggtttttggtgcaggaggacaagccagcatgtgtctgccat
tctgggtacgttggtgcacgctgtgagcatgcggacctcctggctgtggtggccgccagt
cagaagaagcaggccatcaccgccttggtggtggtctccatcgtggccctggctgtcctt
atcatcacatgtgtgctgatacactgctgccaggtccgaaaacactgtgagtggtgccag
gccctcatctgccggcacgagaagcccagcgccctcctgaagggaagaaccgcttgctgc
cactcagaaacagtggtctga

DBGET integrated database retrieval system