KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524622Help
Entry
108524622         CDS       T04641                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00020  Citrate cycle (TCA cycle)
rbb00190  Oxidative phosphorylation
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
rbb04714  Thermogenesis
rbb04932  Non-alcoholic fatty liver disease (NAFLD)
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05016  Huntington disease
Module
rbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rbb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108524622
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108524622
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    108524622
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108524622
   05012 Parkinson disease
    108524622
   05016 Huntington disease
    108524622
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108524622
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108524622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-GeneID: 108524622
NCBI-ProteinID: XP_017721195
LinkDB All DBs
Position
Un
AA seq 204 aa AA seqDB search
HLFLQDTNPLHLCLLCHQWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFD
AVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPIRSHTVAVQGGINAALGNMEEDNWRWHF
YDTVKGSDWXGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
catctgttccttcaggacactaaccctctgcatctgtgtcttctgtgtcaccagtggcca
acagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaacaagagggca
tctgctaaagtttcagattccatttctgctcagtatccagtagtggatcatgaatttgat
gcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctttctgaggca
gggtttaatacagcatgtgttacaaagctgtttcctatcaggtcacacactgttgcagtg
cagggaggaatcaacgctgctctggggaacatggaggaggacaactggaggtggcatttc
tacgacaccgtgaagggctccgactggnctggggaccaggatgccatccactacatgaca
gagcaggctcccgccgccgtggttgagctggaaaattatggcatgccgtttagcagaact
gaagatgggaagatttatcagcgtgcatttggtggacagagcctcaaatttggaaagggc
gggcaggcccatcggtgctgctgtgtggctgatcggaccggccactcactattgcacacc
ttatatggaagg

DBGET integrated database retrieval system