KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526176Help
Entry
108526176         CDS       T04641                                 

Definition
(RefSeq) trypsin-2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04080  Neuroactive ligand-receptor interaction
rbb04972  Pancreatic secretion
rbb04974  Protein digestion and absorption
rbb05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108526176
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    108526176
   04974 Protein digestion and absorption
    108526176
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    108526176
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rbb01002]
    108526176
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108526176
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108526176
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108526176
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108526176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108526176
NCBI-ProteinID: XP_017722311
LinkDB All DBs
Position
Un
AA seq 261 aa AA seqDB search
MHMRETNIFTLKKGKSVPLVFHPPDALIAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYH
FCGGSLINEQWVVSAAHCYKTRIQVRLGEHNIEVLEGTEQFINAAKIIRHPNYNRITLDN
DILLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVL
TQAECEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNRP
GVYTKVYNYVDWIRDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaaatatcttcacattgaagaaggggaagagtgtgccattggtt
ttccatcctccagatgcactgattgctgccccttttgacgatgatgacaagatcgttggg
ggctacacctgtgaggagaattctgtcccctaccaggtgtctctgaattctggctaccac
ttctgtggtggctccctcatcaacgaacagtgggtggtgtcagcagctcactgctacaag
acccgcatccaggtgagactgggagagcacaacatcgaagtcctggagggaactgagcag
ttcatcaatgcagccaagatcatccgccaccccaattataacaggattactctggacaac
gacatcctgctgatcaagctctcctcacctgccgtcatcaatgcccgcgtgtccaccatc
tctctgcccaccgcccctccagctgctggcaccgagtgcctcatctctggctggggcaac
actctgagctctggcgccgactacccagatgagctgcagtgcctggacgcacctgtgctg
acccaggctgagtgtgaagcctcctaccctggaaagattaccagcaacatgttctgtgtg
ggcttcctcgagggaggcaaggattcctgccagggtgactctggtggccctgtggtctcc
aacggacagctccaaggaattgtctcctggggctatggctgtgcccagaagaacaggccc
ggagtctacaccaaggtctacaactatgtggactggattagggacaccatagctgccaac
agctaa

DBGET integrated database retrieval system