KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526259
Entry
108526259         CDS       T04641                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04068  FoxO signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04217  Necroptosis
rbb04650  Natural killer cell mediated cytotoxicity
rbb04722  Neurotrophin signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb04940  Type I diabetes mellitus
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05320  Autoimmune thyroid disease
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108526259 (FASLG)
   04014 Ras signaling pathway
    108526259 (FASLG)
   04068 FoxO signaling pathway
    108526259 (FASLG)
   04151 PI3K-Akt signaling pathway
    108526259 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108526259 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108526259 (FASLG)
   04217 Necroptosis
    108526259 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108526259 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108526259 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108526259 (FASLG)
   05205 Proteoglycans in cancer
    108526259 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108526259 (FASLG)
   05330 Allograft rejection
    108526259 (FASLG)
   05332 Graft-versus-host disease
    108526259 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    108526259 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108526259 (FASLG)
   04932 Non-alcoholic fatty liver disease
    108526259 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108526259 (FASLG)
   05161 Hepatitis B
    108526259 (FASLG)
   05160 Hepatitis C
    108526259 (FASLG)
   05164 Influenza A
    108526259 (FASLG)
   05162 Measles
    108526259 (FASLG)
   05168 Herpes simplex virus 1 infection
    108526259 (FASLG)
   05163 Human cytomegalovirus infection
    108526259 (FASLG)
   05165 Human papillomavirus infection
    108526259 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108526259 (FASLG)
   05143 African trypanosomiasis
    108526259 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108526259 (FASLG)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108526259 (FASLG)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Tumor necrosis fators
   108526259 (FASLG)
CD molecules [BR:rbb04090]
 Proteins
  108526259 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 108526259
NCBI-ProteinID: XP_017722400
UniProt: A0A2K6JTU0
LinkDB
Position
Un
AA seq 280 aa
MQQPFNYPYPQIYWVDSSASSPWVPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQR
HTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggtccctccaggtacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccaccaccgccgccaccgccgccactaccacctccaccaccacca
ccactgcctccactaccgctgccacccttgaagaagagggggaaccacagcacaggcctg
tgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggactggggatg
tttcagctcttccacctacagaaagagctggcagaactccgagagtctaccagccagagg
catacagcatcatctttggagaagcaaataggtcaccccagtccaccccctgaaaaaaag
gagcagaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcctctggaa
tgggaagacacctatggaattgtcctgctttctggagtgaaatataagaagggtggcctt
gtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggtcaatct
tgcaccaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccaggat
ctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcccgc
agcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaatgta
tctgaactctctctggtcaattttgaggaatctcagacattttttggcctatataagctc
taa

DBGET integrated database retrieval system