KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526885
Entry
108526885         CDS       T04641                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04062  Chemokine signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04621  NOD-like receptor signaling pathway
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05200  Pathways in cancer
Module
rbb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108526885 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108526885 (PLCB2)
   04310 Wnt signaling pathway
    108526885 (PLCB2)
   04371 Apelin signaling pathway
    108526885 (PLCB2)
   04020 Calcium signaling pathway
    108526885 (PLCB2)
   04070 Phosphatidylinositol signaling system
    108526885 (PLCB2)
   04072 Phospholipase D signaling pathway
    108526885 (PLCB2)
   04071 Sphingolipid signaling pathway
    108526885 (PLCB2)
   04022 cGMP-PKG signaling pathway
    108526885 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108526885 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108526885 (PLCB2)
   04613 Neutrophil extracellular trap formation
    108526885 (PLCB2)
   04621 NOD-like receptor signaling pathway
    108526885 (PLCB2)
   04062 Chemokine signaling pathway
    108526885 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    108526885 (PLCB2)
   04922 Glucagon signaling pathway
    108526885 (PLCB2)
   04929 GnRH secretion
    108526885 (PLCB2)
   04912 GnRH signaling pathway
    108526885 (PLCB2)
   04915 Estrogen signaling pathway
    108526885 (PLCB2)
   04921 Oxytocin signaling pathway
    108526885 (PLCB2)
   04926 Relaxin signaling pathway
    108526885 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    108526885 (PLCB2)
   04918 Thyroid hormone synthesis
    108526885 (PLCB2)
   04919 Thyroid hormone signaling pathway
    108526885 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    108526885 (PLCB2)
   04916 Melanogenesis
    108526885 (PLCB2)
   04924 Renin secretion
    108526885 (PLCB2)
   04925 Aldosterone synthesis and secretion
    108526885 (PLCB2)
   04927 Cortisol synthesis and secretion
    108526885 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108526885 (PLCB2)
   04270 Vascular smooth muscle contraction
    108526885 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    108526885 (PLCB2)
   04971 Gastric acid secretion
    108526885 (PLCB2)
   04972 Pancreatic secretion
    108526885 (PLCB2)
   04973 Carbohydrate digestion and absorption
    108526885 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    108526885 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    108526885 (PLCB2)
   04725 Cholinergic synapse
    108526885 (PLCB2)
   04728 Dopaminergic synapse
    108526885 (PLCB2)
   04726 Serotonergic synapse
    108526885 (PLCB2)
   04720 Long-term potentiation
    108526885 (PLCB2)
   04730 Long-term depression
    108526885 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    108526885 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    108526885 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    108526885 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108526885 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108526885 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108526885 (PLCB2)
   05016 Huntington disease
    108526885 (PLCB2)
   05017 Spinocerebellar ataxia
    108526885 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    108526885 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108526885 (PLCB2)
   04934 Cushing syndrome
    108526885 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108526885 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108526885 (PLCB2)
   05142 Chagas disease
    108526885 (PLCB2)
   05143 African trypanosomiasis
    108526885 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108526885 (PLCB2)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108526885 (PLCB2)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108526885 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108526885 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PI-PLC-Y EF-hand_like C2 Gp58
Other DBs
NCBI-GeneID: 108526885
NCBI-ProteinID: XP_017723359
LinkDB
Position
Un
AA seq 954 aa
MSLCPRPEIDEIFTSYHAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLID
KYEPSGINVQRGQLSPEGMVWFLCGPENSVLAQDKLLLNHDMTQPLNHYFINSSHNTYLT
AGQFSGLSSAEMYRQVLLSGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIA
ESAFKTSPYPIILSFENHVDSPRQQAKMAEYCRMIFGDMLLTEPLEKFPLKPGVPLPSPE
DLKGKILIKNKKNQFSTPTSSSKDPGGEAEGSSPRSAPAVWAGEEGTELEDDQVEEEEEE
ESGNLDEEEIKKMQSDEGTAGLEVTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSF
TELKAYDLLSKAAVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMD
LPMQQNMAVFEFNGQSGYLLKHEFMRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSE
RSVRTYVEVELFGLPGDPKRRYRTKLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVM
EEGNKFLGHRIIPINALNSGYHHLCLHSESNMPLTMPALFVFLEMKDYVPGAWADLTVAL
ANPIKFFNAHDKRSEKLKEAMGGLPEKPFPLASPVASQVNGALAPRSNGSPEPRTASLEE
LRELKGVVKLQRRHEKELRELERRGVRRWEELLQRGAAQLAELGPRGAGGGGAGKLGPGK
GSRKKRSLPCEESAGAAPGEGPEGMDARVRELKDRLELELLRQGEEQYECVLKRKEQHAA
EQISKMMELAREKQAAELKALKEMAEIDTKEMKKKLETKRLEQIQGMTKVTTDKMAQERL
KREINNSHIQEVVQVIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARM
KGLEAEVKESVRACFRTCFPSETKDKPERDCECPSELCERDPVIAKADAQESRL
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgagcctctgtcctcggccagaaatagatgagatcttcacttcttaccatgctaaggcc
aaaccctacatgacgaaggagcacctgaccaaattcatcaaccagaaacagcgggactcc
cggcttaactccctgctgttcccgccagcacggcctgaccaggtgcagggcctcatcgac
aagtatgagcccagtggcatcaatgtgcagaggggccagctgtcacctgagggcatggtc
tggtttctctgtgggccggagaacagtgtgctggcccaggacaagctgctgctcaaccat
gacatgacacagccactcaatcattacttcatcaactcgtcccacaacacctacctgaca
gccggccagttctcaggcctctcctcggctgagatgtaccgccaggtgctgctgtccggc
tgccgttgcgtggagctagactgctggaaggggaaaccccctgacgaagagcccattatc
acccacggcttcaccatgaccacagacatcttcttcaaagaagcaattgaggctattgca
gaaagcgcctttaagacctccccctatcctatcatcctgtcatttgagaaccatgtggac
tcaccccgccagcaggctaagatggctgagtattgccggatgatcttcggggatatgctg
ctcacagagcccctggaaaagttcccactgaaaccaggtgtccccctgcccagccctgag
gatctcaagggcaagatcctcatcaagaacaagaagaaccagttttccacccccacctcc
tccagtaaggatcctggtggggaggctgagggcagcagcccacgcagtgcccctgcagtg
tgggctggcgaggaagggactgagctggaggacgaccaggtggaagaggaagaggaggag
gagtcaggaaacctggacgaagaagagattaagaagatgcagtcggatgagggcacagca
ggcctggaagtgacagcttatgaggagatgtccagcctagtgaattacattcagcccacc
aagttcatctcctttgagttctctgctcaaaagaaccgaagttatgtcatctcgtccttc
acagaactcaaggcatatgacctgctttccaaggccgcggtgcagtttgtggactacaac
aagcgccagatgagccgcatttaccccaagggaacccgcatggactcctccaactacatg
ccccagatgttctggaatgctggatgccagatggttgccctcaacttccagacgatggac
ttgcccatgcagcagaacatggcagtgtttgagttcaatgggcagagcggctacctcctc
aagcacgagttcatgcgccggccggacaagcagttcaaccccttctcagtggaccgcatc
gacgtggtggtggccaccaccctttctatcacggtgatctctgggcagttcctgtcagaa
cgcagtgtgcgcacctatgtggaagtggagctgtttggccttcctggggaccccaagagg
cgctatcgaactaagctgtcacccagtaccaattccattaatcctgtctggaaggaggag
ccctttgtctttgagaagatcttgatgcctgagctggcctctctcagggtggctgtgatg
gaggaaggcaacaagtttcttggacaccgcatcatccccatcaatgccctaaattctggg
taccaccacctgtgcctacacagtgagagcaacatgcccctcaccatgcctgcgctcttc
gtcttcctggagatgaaggactatgtacctggtgcctgggcagatctcactgtggccctc
gccaaccccatcaagttcttcaatgcccatgacaagaggtctgagaagctcaaggaggcc
atgggagggctgcctgagaagcccttcccactggcgagtccagttgccagccaggtcaat
ggtgcgttggccccaaggagcaatgggtcaccagagccacggaccgccagcctggaggag
ctccgggagctaaagggcgtcgtgaagctgcagcggcggcacgagaaggagctgcgggag
ttggagcggcgcggagtgcggcgctgggaggagctgctgcagcggggcgcggcgcagctg
gccgagctcgggccgcggggcgcggggggtggcggggccggcaagctcggcccgggcaaa
ggctctcgcaagaagaggagcctgccttgcgaggagagcgccggagccgcgccgggcgag
ggccctgagggcatggacgcgcgcgtgcgggagctgaaggacaggctggagctggagctg
ctgcggcagggcgaggagcagtacgagtgcgttctgaagcgcaaggagcagcacgcggcc
gagcaaatctccaaaatgatggagctggccagagagaaacaggcggcagagctgaaggcc
ctgaaggagatggcggagatcgacaccaaagagatgaagaaaaagctggagaccaagaga
ctggagcagatccagggcatgaccaaagtcaccacagataagatggcccaggagaggttg
aagagagagattaacaactcccacatccaggaagtggtgcaggtgatcaagcagatgaca
gagaacttggagaagcaccaggagaagctggaagagaagcaggctgcttgcctggaacag
atacgggagatggaaaagcagttccagaaggaggcgctggcagagtatgaggccaggatg
aagggtctggaggcagaggtgaaggagtcggtgagggcctgcttcaggacctgctttccc
tctgagaccaaggacaagcctgagagggactgcgagtgcccctcagagctgtgtgagcgg
gacccagtcatagcaaaggcagatgcccaggagagccgcctttga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527553
Entry
108527553         CDS       T04641                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04062  Chemokine signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04621  NOD-like receptor signaling pathway
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05200  Pathways in cancer
Module
rbb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108527553 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108527553 (PLCB1)
   04310 Wnt signaling pathway
    108527553 (PLCB1)
   04371 Apelin signaling pathway
    108527553 (PLCB1)
   04020 Calcium signaling pathway
    108527553 (PLCB1)
   04070 Phosphatidylinositol signaling system
    108527553 (PLCB1)
   04072 Phospholipase D signaling pathway
    108527553 (PLCB1)
   04071 Sphingolipid signaling pathway
    108527553 (PLCB1)
   04022 cGMP-PKG signaling pathway
    108527553 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108527553 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108527553 (PLCB1)
   04613 Neutrophil extracellular trap formation
    108527553 (PLCB1)
   04621 NOD-like receptor signaling pathway
    108527553 (PLCB1)
   04062 Chemokine signaling pathway
    108527553 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    108527553 (PLCB1)
   04922 Glucagon signaling pathway
    108527553 (PLCB1)
   04929 GnRH secretion
    108527553 (PLCB1)
   04912 GnRH signaling pathway
    108527553 (PLCB1)
   04915 Estrogen signaling pathway
    108527553 (PLCB1)
   04921 Oxytocin signaling pathway
    108527553 (PLCB1)
   04926 Relaxin signaling pathway
    108527553 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    108527553 (PLCB1)
   04918 Thyroid hormone synthesis
    108527553 (PLCB1)
   04919 Thyroid hormone signaling pathway
    108527553 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    108527553 (PLCB1)
   04916 Melanogenesis
    108527553 (PLCB1)
   04924 Renin secretion
    108527553 (PLCB1)
   04925 Aldosterone synthesis and secretion
    108527553 (PLCB1)
   04927 Cortisol synthesis and secretion
    108527553 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108527553 (PLCB1)
   04270 Vascular smooth muscle contraction
    108527553 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    108527553 (PLCB1)
   04971 Gastric acid secretion
    108527553 (PLCB1)
   04972 Pancreatic secretion
    108527553 (PLCB1)
   04973 Carbohydrate digestion and absorption
    108527553 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    108527553 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    108527553 (PLCB1)
   04725 Cholinergic synapse
    108527553 (PLCB1)
   04728 Dopaminergic synapse
    108527553 (PLCB1)
   04726 Serotonergic synapse
    108527553 (PLCB1)
   04720 Long-term potentiation
    108527553 (PLCB1)
   04730 Long-term depression
    108527553 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    108527553 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    108527553 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    108527553 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108527553 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527553 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108527553 (PLCB1)
   05016 Huntington disease
    108527553 (PLCB1)
   05017 Spinocerebellar ataxia
    108527553 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    108527553 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108527553 (PLCB1)
   04934 Cushing syndrome
    108527553 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108527553 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108527553 (PLCB1)
   05142 Chagas disease
    108527553 (PLCB1)
   05143 African trypanosomiasis
    108527553 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108527553 (PLCB1)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108527553 (PLCB1)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108527553 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108527553 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like PH_14 DUF1154 C2
Other DBs
NCBI-GeneID: 108527553
NCBI-ProteinID: XP_017724367
LinkDB
Position
Un
AA seq 1081 aa
MITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKL
QVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCP
RPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
NSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLA
GNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFK
TSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYK
ILVKNKKKSHKSSEGSGKKKLSEQASNTCSDSSSMFEPSSPGAGEADTESDDDDDDDDCK
KSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTK
SPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMVIRLTWNYKLID
AAFFVVIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFK
KVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEV
KDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSETPSEV
RTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQ
QKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKRTVR
KKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHI
KLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEK
TEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFK
RLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTP
L
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgatcacggtggtgtatggacctgacctcgtgaacatctcccatttgaatctcgtggct
ttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaacctg
ctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaagctg
caagtcactccagaggggcgtattcctctcaaaaacatatatcgcttgttttcagcagac
cggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgattca
atacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgccct
cgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatcttacc
gttgaccagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaaata
ctttatccaccgctaaaacaagagcaagtccaagtattgattgagaagtatgaacccaac
aacagcctcgccaaaaaaggacaaatatcagtggatgggttcatgcgctatctgagtgga
gaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcagccc
ctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactggct
ggaaactcctctgttgagatgtatcgccaagtgcttctgtctggttgtcgctgtgtggag
ctggactgctggaagggacgaactgcagaagaggaacctgtcatcacccatggcttcacc
atgacaactgaaatatctttcaaggaagtgatagaagcaatagcggagtgtgcatttaag
acttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcagcaa
gccaagatggcggagtactgccgactgatcttcggggatgcccttctcatggagcccctg
gaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtataaa
attttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaagaag
ctctcagaacaagcctccaacacctgcagtgactcctccagcatgttcgagccctcatcc
ccaggagccggagaagctgatacggaaagtgacgacgatgatgatgatgatgactgtaaa
aaatcttcaatggatgaggggaccgctggaagtgaggctatggccacagaagaaatgtct
aacctggtgaactacattcagccggtcaagtttgagtcatttgaaatttcaaaaaaaaga
aataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcaccaag
tctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaagga
acacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcagatg
gtggcacttaatttccagacaatggtcatccgactgacctggaattacaagttaatagat
gcagccttttttgttgtgattatttcaggtcagtttctttctgataagaaagtcgggact
tatgtggaagtggatatgtttggtttgcctgtggatacaaggaggaaggcatttaagacc
aagacatcccaaggaaatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaa
aaggtggttcttcctactctggcctgtttgagaatagcagtttatgaagaaggaggtaaa
ttcattggccaccgtatcttgccagtgcaagccattcggccaggctatcactatatatgt
ctaaggaatgaaaggaaccagcctctgacactgcctgctgtctttgtctacatagaagtg
aaagactatgtgccagacacatatgcagatgtcattgaagctttatcaaacccaatccgg
tatgtgaacctgatggagcagagagctaagcaattggctgctttgacactggaagatgaa
gaagaagtaaagaaagaggctgatcctggagaaacaccatcagagactccaagtgaagtg
agaacgactccagcagaaaacggggtgaatcacactacatccctgacacccaagccaccc
tcccaggctctccacagccaaccagctccaggttctgtaaaggcacctgccaaaacagaa
gatcttattcagagtgtcttaacagaagtggaagcacagaccatcgaagagctaaagcaa
cagaaatcgtttgtgaaacttcaaaagaagcactacaaagaaatgaaagacctggttaag
agacaccacaagaaaaccactgacctgatcaaagaacacactaccaagtataatgaaatt
cagaatgactacttgagaaggagagcagctttggaaaagtccgccaaaaggacagtaaga
aaaaaatcggaacccagcagccctgatcatggttcatcaacgattgagcaagacctcgct
gccctggatgctgaaatgacccaaaaattaatagacttgaaggacaaacaacagcagcag
ctgcttaatcttcgacaagaacagtattatagtgaaaaataccagaagcgagaacatatt
aaactgcttattcaaaagttgacggatgtcgcagaagagtgtcagaacaatcagttaaag
aagctcaaagaaatctgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaag
aggcaggagaagataacagaagctaaatctaaagacaaaagtcagatggaagaggagaag
acagagatgatccggtcatatatccaggaagtggtgcagtacatcaagaggctagaagag
gcgcaaagtaaacggcaagaaaaactcgtagagaaacacaaggaaatacgtcagcagatc
ctggatgaaaagcccaagctgcaggtggagctggagcaagaataccaagacaaattcaaa
agactgcccctcgagattttggaatttgtgcaggaagccatgaaaggaaagatcagtgaa
gacagcaatcacggttctgcccctctctccctgtcctcagaccctggaaaagtgaaccac
aagactccctccagtgaggagctgggaggagacatcccaggaaaagaatttgatactcct
ctgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527564
Entry
108527564         CDS       T04641                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04062  Chemokine signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04621  NOD-like receptor signaling pathway
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05200  Pathways in cancer
Module
rbb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108527564 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108527564 (PLCB4)
   04310 Wnt signaling pathway
    108527564 (PLCB4)
   04371 Apelin signaling pathway
    108527564 (PLCB4)
   04020 Calcium signaling pathway
    108527564 (PLCB4)
   04070 Phosphatidylinositol signaling system
    108527564 (PLCB4)
   04072 Phospholipase D signaling pathway
    108527564 (PLCB4)
   04071 Sphingolipid signaling pathway
    108527564 (PLCB4)
   04022 cGMP-PKG signaling pathway
    108527564 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108527564 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108527564 (PLCB4)
   04613 Neutrophil extracellular trap formation
    108527564 (PLCB4)
   04621 NOD-like receptor signaling pathway
    108527564 (PLCB4)
   04062 Chemokine signaling pathway
    108527564 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    108527564 (PLCB4)
   04922 Glucagon signaling pathway
    108527564 (PLCB4)
   04929 GnRH secretion
    108527564 (PLCB4)
   04912 GnRH signaling pathway
    108527564 (PLCB4)
   04915 Estrogen signaling pathway
    108527564 (PLCB4)
   04921 Oxytocin signaling pathway
    108527564 (PLCB4)
   04926 Relaxin signaling pathway
    108527564 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    108527564 (PLCB4)
   04918 Thyroid hormone synthesis
    108527564 (PLCB4)
   04919 Thyroid hormone signaling pathway
    108527564 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    108527564 (PLCB4)
   04916 Melanogenesis
    108527564 (PLCB4)
   04924 Renin secretion
    108527564 (PLCB4)
   04925 Aldosterone synthesis and secretion
    108527564 (PLCB4)
   04927 Cortisol synthesis and secretion
    108527564 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108527564 (PLCB4)
   04270 Vascular smooth muscle contraction
    108527564 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    108527564 (PLCB4)
   04971 Gastric acid secretion
    108527564 (PLCB4)
   04972 Pancreatic secretion
    108527564 (PLCB4)
   04973 Carbohydrate digestion and absorption
    108527564 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    108527564 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    108527564 (PLCB4)
   04725 Cholinergic synapse
    108527564 (PLCB4)
   04728 Dopaminergic synapse
    108527564 (PLCB4)
   04726 Serotonergic synapse
    108527564 (PLCB4)
   04720 Long-term potentiation
    108527564 (PLCB4)
   04730 Long-term depression
    108527564 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    108527564 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    108527564 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    108527564 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108527564 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527564 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108527564 (PLCB4)
   05016 Huntington disease
    108527564 (PLCB4)
   05017 Spinocerebellar ataxia
    108527564 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    108527564 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108527564 (PLCB4)
   04934 Cushing syndrome
    108527564 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108527564 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108527564 (PLCB4)
   05142 Chagas disease
    108527564 (PLCB4)
   05143 African trypanosomiasis
    108527564 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108527564 (PLCB4)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108527564 (PLCB4)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108527564 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108527564 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 108527564
NCBI-ProteinID: XP_017724379
LinkDB
Position
Un
AA seq 1201 aa
MNLTGRRKFLPFARRSSFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLI
NSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGIDLVNISFTYMVAENPEVTKQW
VEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQA
LKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSF
LNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVF
LDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGK
GEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCE
DLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGE
SASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKASDDLEHE
NNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMS
SFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQT
PDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFL
SDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIA
VYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVD
ALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSEL
RPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTM
QKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKV
KEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLISAHEQQTQQLKLSHDRES
KEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEM
DQLKKVQLEHLEFLEQQNEQLLKSCHAVSQSQGEGDAADGEIGSRDGPQTSNSSMKLQNA
N
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgaatttaactggcagaaggaagttccttccttttgcaagaaggagcagttttgacaga
tacgaagaggaatcctttgtgtttgaacccaactgcctcttcaaagtggatgagtttggc
ttctttctgacatggaaaagtgaaggcaaggaaggacaggtgctagaatgctccctcatc
aacagtattcggtcgggagccataccaaaggatcccaaaatcttggctgctcttgaagct
gttggaaaatcagaaaatgatctcgaaggtcgaatagtttgtgtctgcagtggcatagat
ctagtgaacattagttttacctacatggtggctgaaaatccagaagtaactaagcaatgg
gtagaaggcctgagatcaatcatacacaacttcagggccaacaatgtcagtccaatgacg
tgcctcaagaaacactggatgaaattggcatttatgaccaacacaaatggtaaaattcca
gttaggagtattactagaacctttgcatcggggaaaacagaaaaggtgatctttcaagca
ctcaaggagttaggtcttcccagtggaaagaatgatgaaattgagcccacggcatttact
tatgaaaagttctatgaactgacacaaaagatttgtcctcggacagatatagaagatctt
ttcaaaaaaatcaatggagacaaaactgattatttaacggtagaccaattagtgagcttt
ctaaatgaacatcaacgagatcctcgattgaatgaaattttatttccattttatgatgcc
aaaagggcaatgcagatcattgagatgtatgaacctgatgaagatttgaagaaaaaaggc
cttatatcaagtgatgggttttgcagatatctgatgtcagatgaaaatgccccagtcttc
ctagatcgtttagaactttaccaagaaatggaccatcctctggctcactacttcatcagt
tcttcccataacacttatctgactggcagacagtttggtgggaagtcttcggtagaaatg
tacagacaggttctcctggctggttgcagatgtgttgaacttgactgctgggatggaaaa
ggtgaagaccaagaaccaataataactcatgggaaagcaatgtgtacagatatccttttt
aaggatgtaattcaagccatcaaggaaactgcatttgtcacatcagaatatcctgtaatt
ctctcctttgaaaatcactgcagcaaatatcaacagtacaagatgtccaaatattgcgaa
gatctatttggggatctcctgttgaaacaagcgcttgaatcacatccacttgaaccaggc
aggcctttgccatcccccaatgacctcaaaagaaaaatactcataaaaaacaagcggctg
aaacctgaagttgaaaaaaaacagctggaagctttgagaagcatgatggaagctggagaa
tctgcctccccagcaaacatcttagaggatgataatgaagaggagatcgaaagtgctgac
caagaggaggaagctcaccccgaattcaaatttggaaatgaactttctgctgatgacttg
ggtcacaaggaagctgttgcaaatagcgtcaagaaggcctcagatgaccttgaacatgaa
aacaacaaaaagggtctggtaactgtagaagatgagcaggcgtggatggcatcttataaa
tatgtaggtgctaccactaatatccatccatatttgtccacaatgatcaactacgcccag
cctgtaaagtttcaaggtttccatgtggcagaagaacgcaatattcattataacatgtct
tcttttaatgaatcagtcggtcttggctacttgaagacacatgcaattgaatttgtcaat
tataacaaacggcaaatgagtcgcatttaccccaagggaggccgagtggattccagtaat
tacatgcctcagattttctggaacgctggctgccagatggtttcgctgaactatcaaacc
ccagatttagcgatgcaattgaatcagggaaaatttgagtataatggatcgtgcgggtac
cttctcaaaccagatttcatgaggcggcctgatcgaacatttgaccccttctctgaaact
cctgttgatggcgttattgcagccacttgctcagtgcaggttatatcaggtcaattctta
tcagataagaaaattggcacctatgtagaagtggatatgtatgggttgcccactgacacc
atacgtaaggaattccgaactcgtatggttatgaataatggactaaatccagtttacaat
gaagagtcatttgtatttcggaaggtgatcctgccagacctggctgtcttgagaatagca
gtgtatgatgataacaacaagctgattggccagaggatcctcccacttgatggcctccaa
gcaggataccgacacatttcccttcgaaatgagggaaataaaccattatcactgccaaca
attttctgcaatattgttcttaaaacatacgtgcctgatggatttggagatattgtggat
gctttatcagatccaaagaaatttctctcaattacagaaaagagagcagaccaaatgaga
gctatgggaattgaaactagtgacatagccgatgtgcccagtgacacttccaaaaatgac
aagaaaggaaaggccaacaccgccaaagcaaacgtgacccctcagagtagctctgagctc
agaccaaccaccacagctgccctggcctctggtgtggaagccaagaaaggtattgaactt
atccctcaagtaaggatagaagatttaaagcagatgaaggcttacttgaagcatttaaag
aaacagcagaaagagctaaattctttaaagaagaaacatgcaaaggagcacagtaccatg
cagaagctacactgcacgcaagttgacaaaattgtggcacagtatgacaaagagaagtcg
actcatgagaaaatcctagagaaggcaatgaagaagaaagggggaagtaattgtcttgaa
atgaaaaaagaaacagaaattaaaattcagacgctgacatcagatcacaaatctaaggtc
aaagagattgtagcacagcacacaaaggaatggtcagaaatgatcaatacccacagtgct
gaggagcaagaaatccgagacctgcatctcagccagcagtgtgagctgctgaaaaagcta
ctcatcagtgcccacgagcaacaaacccagcagctgaaactgtcccatgacagggaaagc
aaggaaatgcgagcacaccaggctaagatttctatggaaaatagcaaagccatcagccaa
gataaatctatcaagaataaggcagaacgggaaaggcgagtcagggagttaaacagcagc
aacactaaaaagtttctggaagaaagaaagagactcgcaatgaagcagtccaaagaaatg
gatcagttgaaaaaagtccagcttgaacatctagaattcctagagcaacagaatgagcag
cttttgaaatcctgtcatgcagtgtcccaatcgcaaggcgaaggagatgcagcagatggt
gaaattggaagccgagatggaccgcagaccagcaacagtagtatgaaactccaaaatgca
aactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542252
Entry
108542252         CDS       T04641                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04062  Chemokine signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04621  NOD-like receptor signaling pathway
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05200  Pathways in cancer
Module
rbb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108542252 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108542252 (PLCB3)
   04310 Wnt signaling pathway
    108542252 (PLCB3)
   04371 Apelin signaling pathway
    108542252 (PLCB3)
   04020 Calcium signaling pathway
    108542252 (PLCB3)
   04070 Phosphatidylinositol signaling system
    108542252 (PLCB3)
   04072 Phospholipase D signaling pathway
    108542252 (PLCB3)
   04071 Sphingolipid signaling pathway
    108542252 (PLCB3)
   04022 cGMP-PKG signaling pathway
    108542252 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108542252 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108542252 (PLCB3)
   04613 Neutrophil extracellular trap formation
    108542252 (PLCB3)
   04621 NOD-like receptor signaling pathway
    108542252 (PLCB3)
   04062 Chemokine signaling pathway
    108542252 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    108542252 (PLCB3)
   04922 Glucagon signaling pathway
    108542252 (PLCB3)
   04929 GnRH secretion
    108542252 (PLCB3)
   04912 GnRH signaling pathway
    108542252 (PLCB3)
   04915 Estrogen signaling pathway
    108542252 (PLCB3)
   04921 Oxytocin signaling pathway
    108542252 (PLCB3)
   04926 Relaxin signaling pathway
    108542252 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    108542252 (PLCB3)
   04918 Thyroid hormone synthesis
    108542252 (PLCB3)
   04919 Thyroid hormone signaling pathway
    108542252 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    108542252 (PLCB3)
   04916 Melanogenesis
    108542252 (PLCB3)
   04924 Renin secretion
    108542252 (PLCB3)
   04925 Aldosterone synthesis and secretion
    108542252 (PLCB3)
   04927 Cortisol synthesis and secretion
    108542252 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108542252 (PLCB3)
   04270 Vascular smooth muscle contraction
    108542252 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    108542252 (PLCB3)
   04971 Gastric acid secretion
    108542252 (PLCB3)
   04972 Pancreatic secretion
    108542252 (PLCB3)
   04973 Carbohydrate digestion and absorption
    108542252 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    108542252 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    108542252 (PLCB3)
   04725 Cholinergic synapse
    108542252 (PLCB3)
   04728 Dopaminergic synapse
    108542252 (PLCB3)
   04726 Serotonergic synapse
    108542252 (PLCB3)
   04720 Long-term potentiation
    108542252 (PLCB3)
   04730 Long-term depression
    108542252 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    108542252 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    108542252 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    108542252 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108542252 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108542252 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108542252 (PLCB3)
   05016 Huntington disease
    108542252 (PLCB3)
   05017 Spinocerebellar ataxia
    108542252 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    108542252 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108542252 (PLCB3)
   04934 Cushing syndrome
    108542252 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108542252 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108542252 (PLCB3)
   05142 Chagas disease
    108542252 (PLCB3)
   05143 African trypanosomiasis
    108542252 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108542252 (PLCB3)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108542252 (PLCB3)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108542252 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108542252 (PLCB3)
SSDB
Motif
Pfam: PLC-beta_C PH_14 PI-PLC-Y PI-PLC-X EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 108542252
NCBI-ProteinID: XP_017747688
LinkDB
Position
Un
AA seq 1182 aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPSGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTGERGARVGPMASALCLLWAAAVW
IWMVWKGRPAEEERLHQPIGFTMTRGALLPATWLEAIARLAFKTSPYPVILALREPTWIY
PLNSPLSHLYLLGKTPPGFLSSYVVLTPDLVALSSAGSPSSDSCPGLSNGEEGGLEKPSL
EPRKSLGEEGLNRGPYALGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMST
LVNYIEPVKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGT
RVDSSNYMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSF
DPFTEVIVDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSF
NPVWDEEPFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQP
LCLPALLIYTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQEMC
QDTQSQQLGSQLSPNPTPSPLDASPRRPPGPTTSPTSTSLSSPGQRDDLIASILSEVAPT
PLDELRGHKALVKLQSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGAL
GGAADVEDTKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVV
LDANTTQFKRLKEMNEREKKELQKILDRKRHNSISEAKTRDKHKKEAELTEINRRHITES
VNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLL
GEMPEGLGDGLLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3549 nt   +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccagtggcttcttcttgtactggacaggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctgttcaagctggctatg
aacatcctggctcagaatgcctcccggaacaccttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaatttcaaccggagt
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacactggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgccgctgcggccctcccaggcccgactgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcaccgacatgacc
cagccgctgagtgcctacttcatcaactcctcgcataacacctatctcactggtgagcgg
ggagcaagggtggggcccatggcctctgccctgtgcctgctgtgggctgccgctgtgtgg
atctggatggtgtggaaaggacggcccgccgaggaggaacgcctgcatcaacccattggc
ttcaccatgacccgaggtgccctcttgcccgcgacgtggctggaggccattgcgagactg
gccttcaagacctcgccctatcccgtcatcctcgctcttcgagaacctacgtggatctac
cccttgaattccccactgagtcacctgtacttactgggaaaaacccctccaggcttccta
agcagctatgtggtcctgacccctgaccttgtggccctgtcctctgcagggtcgcccagc
tctgacagctgcccaggcctgagcaacggggaggagggggggcttgagaagcccagccta
gagcctcggaagtctctgggcgaggagggcctgaaccggggcccctatgctcttggacct
gctgaccgtgaggatgaggaggaagatgaggaagaggaggagcagacagaccccaaaaag
ccgaccacagatgagggcacggccagcagcgaggtgaatgccactgaggagatgtccacg
cttgtcaactacatcgagcctgtcaagttcaagtcctttgaggctgctcgaaagaggaac
aaatgcttcgagatgtcgtccttcgtggagaccaaggccatggagcaactgaccaagagt
cccatggagtttgtggaatacaacaagcagcagctcagccgcatctaccccaagggcacc
cgtgtggactcttccaactacatgccccagctcttctggaacgtagggtgccagcttgtt
gcgctcaacttccagacccttgatgtggcgatgcagctcaacgcgggcgtttttgagtac
aacgggcgcagcgggtacctgctgaagccggagttcatgcggcggcctgacaaatccttc
gaccccttcactgaggtcatcgtggatggcatcgtggccaatgccttgcgggtcaaggtg
atctcggggcagttcctatccgacaggaaggtgggcatctacgtggaggtggacatgttt
ggcctccctgttgacacgcggcgcaagtaccgcacccggacctctcaggggaactcgttc
aaccccgtgtgggatgaggagccctttgacttccccaaggtggtgctgcctacgctggct
tcacttcgcatcgcagcctttgaggaggggggtaaatttgtagggcaccggatcctgcct
gtctctgccatccgctctggttaccactacgtctgcctgcggaacgaggccaaccagccg
ctgtgccttccggccctgctcatctacactgaagcctcggactacattcctgatgaccac
caggactacgcggaggccctgatcaaccccattaagcacgtcagcctgatggaccagagg
gcccggcagctggccgccctcattggggagagtgaggctcaggctggccaagagatgtgc
caggacacccagtctcagcagctggggtctcagctgtccccaaaccccacccctagccca
ctggatgcctccccccgccggccccctggccccaccacctcccctaccagcacctccctc
agcagcccagggcagcgtgacgatctcatcgccagcatcctctcagaggtggcccccacc
ccgctggatgagctccgaggtcacaaggctctggtcaagctccagagccggcaagagcga
gacctgcgggagctgcgcaagaagcatcagcggaaggcagtcaccctcacccgccgcctg
ctggatggcctggctcaggcacaggctgagggcaggtgccggctgcggccaggtgcccta
ggcggggccgctgatgtggaggacacgaaggagggggaggacgaggcaaagcggtatcag
gagttccagaacagacaggtgcagagcctgctggagctgcgggaggcccaggtggacgca
gaggcccagcggaggctggagcatctgagacaggctctgcagcggctcagggaggtcgtc
cttgatgcaaacacaactcagttcaagaggctgaaagagatgaacgagagggagaagaag
gaactgcagaagattctggacagaaagcgccataacagcatctcggaggccaagacgagg
gataagcataagaaggaggcggaactgacggagattaaccgtcggcacatcactgagtca
gtcaactccatccgtcggctggaggaggcccagaagcagcggcatgaccgtcttgtggct
gggcagcagcaggtcctgcaacagctggcagaagaggagcccaagctgctggcccagctg
gcccaggagtgtcaggagcagcgggcgaggctcccccaggagatccgcaggagcctgctg
ggcgagatgccggaggggctgggggatgggcttctggtggcctgtgccagcaacggtcac
gcacctgggagcagcgggcacctgtcgggcgctgactcggagagccaggaggagaacaca
cagctctga

DBGET integrated database retrieval system