KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526950
Entry
108526950         CDS       T04641                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04014  Ras signaling pathway
rbb04390  Hippo signaling pathway
rbb04392  Hippo signaling pathway - multiple species
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05219  Bladder cancer
rbb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108526950 (RASSF1)
   04390 Hippo signaling pathway
    108526950 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    108526950 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108526950 (RASSF1)
   05206 MicroRNAs in cancer
    108526950 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    108526950 (RASSF1)
   05223 Non-small cell lung cancer
    108526950 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1
Other DBs
NCBI-GeneID: 108526950
NCBI-ProteinID: XP_017723468
LinkDB
Position
Un
AA seq 474 aa
MSAEPELIELRELAPAGRAGQGRTRLERANALRIARGTTCNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVV
GSLSGAAGAMRSFLEAKCACPRPGVPPSMTQELVPGDLRFSLNGCGAALAQAHAHTDTRT
RTHATGAVVGGYGRAGPGGRAGAAMGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFT
ARTSLARRPRRDQDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKV
QLKLVRPVSVPSSKKPPSLQDARRGPGRSTSVRRRTSFYLPKDAVKHLHVLSRTRAREVI
EALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALTFVLKEN
DSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtcggcggagcctgagctcattgagctgcgggagctggcacctgctgggcgcgctggg
cagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggtaccacgtgc
aaccccgcacggcagctggtcccgggccgtggccaccgcttccagcccgctgggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctgcctggac
tgctgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggtg
gggtctctgagtggagctgccggagcgatgaggtcattcctcgaagctaagtgtgcgtgt
ccccgccccggcgttcctccctcaatgacacaagagctagttcccggcgatctacgtttc
agtcttaacggttgcggcgcggcgctggcccaggcgcacgcgcacactgacacgcgtaca
cgcacgcacgcgaccggggcggtggttggcggctacggacgcgcgggaccagggggacgg
gcgggtgcggcgatgggcgaggcggagacgccttctttcgagatgacctggagcagcacg
acgagcagtggctactgcagccaagaggactcagactcggagctcgagcagtacttcacc
gcgcgaacctcgctagcgcgcaggccgcgccgggaccaggatgagcctgtggagtgggag
acacctgacctttctcaagctgagattgagcagaagatcaaggagtacaatgcccagatc
aatagcaacctcttcatgagcttgaacaaggacggttcttacacaggcttcatcaaggtt
cagctgaagctggtgcgccctgtctctgtgccctccagcaagaagccaccctccttgcag
gatgcccggcggggcccaggacggagcacaagtgtcaggcgccgcacttccttttacctg
cccaaggatgctgtcaagcacctgcatgtgctgtcacgcacaagggcacgtgaagtcatt
gaggccctgctgcgaaagttcttggtggtggatgacccccgcaagtttgcactctttgag
cgggctgagcgtcacggccaagtgtacttgcgaaagctgttggatgatgagcagcccctg
cggctgcggctcctggcagggcccagtgacaaggccctgaccttcgtcctgaaggaaaat
gactctggggaggtgaactgggacgccttcagcatgcctgaactacataacttcctgcgt
atcctgcagcgggaggaggaggagcacctccgccagatcctgcagaagtactcctattgc
cgccagaagatccaagaggccctgcacgcctgccccctcgggtga

DBGET integrated database retrieval system