KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527683Help
Entry
108527683         CDS       T04641                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04114  Oocyte meiosis
rbb04140  Autophagy - animal
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04340  Hedgehog signaling pathway
rbb04371  Apelin signaling pathway
rbb04530  Tight junction
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04713  Circadian entrainment
rbb04714  Thermogenesis
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04910  Insulin signaling pathway
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04913  Ovarian steroidogenesis
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04962  Vasopressin-regulated water reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04976  Bile secretion
rbb05012  Parkinson disease
rbb05020  Prion diseases
rbb05030  Cocaine addiction
rbb05031  Amphetamine addiction
rbb05032  Morphine addiction
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108527683 (PRKACB)
   04010 MAPK signaling pathway
    108527683 (PRKACB)
   04310 Wnt signaling pathway
    108527683 (PRKACB)
   04340 Hedgehog signaling pathway
    108527683 (PRKACB)
   04371 Apelin signaling pathway
    108527683 (PRKACB)
   04020 Calcium signaling pathway
    108527683 (PRKACB)
   04024 cAMP signaling pathway
    108527683 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108527683 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108527683 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108527683 (PRKACB)
   04540 Gap junction
    108527683 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108527683 (PRKACB)
   04062 Chemokine signaling pathway
    108527683 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    108527683 (PRKACB)
   04910 Insulin signaling pathway
    108527683 (PRKACB)
   04922 Glucagon signaling pathway
    108527683 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    108527683 (PRKACB)
   04912 GnRH signaling pathway
    108527683 (PRKACB)
   04913 Ovarian steroidogenesis
    108527683 (PRKACB)
   04915 Estrogen signaling pathway
    108527683 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    108527683 (PRKACB)
   04921 Oxytocin signaling pathway
    108527683 (PRKACB)
   04926 Relaxin signaling pathway
    108527683 (PRKACB)
   04918 Thyroid hormone synthesis
    108527683 (PRKACB)
   04919 Thyroid hormone signaling pathway
    108527683 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    108527683 (PRKACB)
   04916 Melanogenesis
    108527683 (PRKACB)
   04924 Renin secretion
    108527683 (PRKACB)
   04925 Aldosterone synthesis and secretion
    108527683 (PRKACB)
   04927 Cortisol synthesis and secretion
    108527683 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108527683 (PRKACB)
   04270 Vascular smooth muscle contraction
    108527683 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    108527683 (PRKACB)
   04971 Gastric acid secretion
    108527683 (PRKACB)
   04976 Bile secretion
    108527683 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    108527683 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108527683 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    108527683 (PRKACB)
   04727 GABAergic synapse
    108527683 (PRKACB)
   04725 Cholinergic synapse
    108527683 (PRKACB)
   04728 Dopaminergic synapse
    108527683 (PRKACB)
   04726 Serotonergic synapse
    108527683 (PRKACB)
   04720 Long-term potentiation
    108527683 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    108527683 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    108527683 (PRKACB)
   04742 Taste transduction
    108527683 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    108527683 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    108527683 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    108527683 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108527683 (PRKACB)
   04714 Thermogenesis
    108527683 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527683 (PRKACB)
   05205 Proteoglycans in cancer
    108527683 (PRKACB)
   05203 Viral carcinogenesis
    108527683 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108527683 (PRKACB)
   05020 Prion diseases
    108527683 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    108527683 (PRKACB)
   05031 Amphetamine addiction
    108527683 (PRKACB)
   05032 Morphine addiction
    108527683 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    108527683 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108527683 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108527683 (PRKACB)
   05163 Human cytomegalovirus infection
    108527683 (PRKACB)
   05165 Human papillomavirus infection
    108527683 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108527683 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108527683 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108527683 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rbb03019]
    108527683 (PRKACB)
   03036 Chromosome and associated proteins [BR:rbb03036]
    108527683 (PRKACB)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108527683 (PRKACB)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKA family
   108527683 (PRKACB)
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     108527683 (PRKACB)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108527683 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 108527683
NCBI-ProteinID: XP_017724587
UniProt: A0A2K6MG59
LinkDB All DBs
Position
Un
AA seq 398 aa AA seqDB search
MAAYREPPCNQYTGTTTALQKLEGFANRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttatagagaaccaccttgtaaccagtatacaggtacaactacagctcttcag
aaattggaaggttttgctaaccggttatttcatagacactctaaaggtactgcacatgat
cagaaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggac
agatcaatgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaat
ccaactcagaataatgccggacttgaagattttgaaaggaaaaaaacccttggaacaggt
tcatttggaagagtcatgttggtaaaacacaaagccactgaacagtattatgccatgaag
atcttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaa
agaatattacaggcagtgaattttcctttccttgttcgactggagtatgcttttaaggat
aattctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatcta
agaagaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgcta
acattcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctc
ttaattgaccatcaaggctatatccaggtcacagactttgggtttgccaaaagagttaaa
ggcagaacttggacattatgtggaactccagagtatttggctccagaaataattctcagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttct
ggaaaggtccgattcccatcccacttcagttcagatctcaaggaccttctacggaacctg
ctgcaggtggatttgaccaagagatatggaaatctaaagaatggtgtcagtgatataaaa
actcacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtctctataacagaaaaatgtgcaaaagaatttggtgaattttaa

DBGET integrated database retrieval system