KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527866
Entry
108527866         CDS       T04641                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04062  Chemokine signaling pathway
rbb04217  Necroptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05212  Pancreatic cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108527866 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108527866 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108527866 (STAT1)
   04621 NOD-like receptor signaling pathway
    108527866 (STAT1)
   04625 C-type lectin receptor signaling pathway
    108527866 (STAT1)
   04658 Th1 and Th2 cell differentiation
    108527866 (STAT1)
   04659 Th17 cell differentiation
    108527866 (STAT1)
   04062 Chemokine signaling pathway
    108527866 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108527866 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    108527866 (STAT1)
   04919 Thyroid hormone signaling pathway
    108527866 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108527866 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527866 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108527866 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108527866 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108527866 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108527866 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108527866 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108527866 (STAT1)
   05160 Hepatitis C
    108527866 (STAT1)
   05171 Coronavirus disease - COVID-19
    108527866 (STAT1)
   05164 Influenza A
    108527866 (STAT1)
   05162 Measles
    108527866 (STAT1)
   05168 Herpes simplex virus 1 infection
    108527866 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108527866 (STAT1)
   05169 Epstein-Barr virus infection
    108527866 (STAT1)
   05165 Human papillomavirus infection
    108527866 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108527866 (STAT1)
   05140 Leishmaniasis
    108527866 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108527866 (STAT1)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108527866 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra BLI1
Other DBs
NCBI-GeneID: 108527866
NCBI-ProteinID: XP_017724853
UniProt: A0A2K6MM56
LinkDB
Position
Un
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgaacttcagcagcttgactcaaaattcctggagcaggttcaccag
ctttatgatgacagttttcccatggaaatcagacaatacctggcacagtggttagaaaag
caagactgggagcacgctgccaatgatgtttcatttgccaccatccgttttcatgacctc
ctatcacagctggatgatcaatatagtcgcttttctttggagaataacttcttgctacag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatccag
atgtctatgatcatttacaactgtctgaaggaagaaaggaaaattctggaaaatgcccag
agatttaatcaggcccagtcggggaatattcagagcacagtgatgttagacaaacagaaa
gagcttgacagtaaagtcagaaatgtgaaggacaaggttatgtgtatagagcatgaaatc
aagagcctggaagatttacaagatgaatatgacttcaaatgcaaaaccttgcagaacaga
gaacacgagaccaatggtgtggcaaagagtgatcagaaacaagaacagctgttactcaag
aagatgtatttaatgcttgacaataaaagaaaggaagtagttcacaaaataatcgagttg
ttgaatgtcactgaacttacccagaatgccctgattaatgatgaactagtggagtggaag
cggagacagcagagcgcctgtattggggggccgcccaatgcttgcctggatcagctgcag
aactggttcaccatagttgcagagagtctgcagcaagttcggcagcagcttaaaaagctg
gaggaattggaacagaaatacacgtacgaacatgaccctatcacaaaaaacaaacaagtg
ttatgggaccgtaccttcagtcttttccagcagctcattcagagctcgtttgtggtggaa
agacagccctgcatgccaacgcaccctcagaggccgctggtcttgaagacaggggtccag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaggtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacgcacacaaaggtgatgaacatggaggagtccaccaatggcagtctg
gcggctgaatttcggcacctgcaattgaaagaacagaaaaatgctggcaccagaacgaat
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccaattgtgc
cagcctggtttggtaattgacctcgagacgacctctctgcccgttgtggtgatctctaac
gtcagccagctcccgagcggttgggcctccatcctttggtacaacatgctggtggcggaa
cccaggaatctgtccttcttcctgaatccaccatgtgcacgttgggctcagctttcagaa
gtgctgagttggcagttttcctctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgttgggagagaagcttcttggtcctaacgccagccccgatggtctcattccgtggacg
aggttttgtaaggaaaatataaatgataaaaattttcccttctggctttggattgaaagc
atcctagaactcattaaaaaacacctgcttcctctctggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgcgccctgttgaaggaccagcagccagggaccttcctg
ctgcggttcagtgagagctcccgggaaggggccatcacattcacatgggtggagcggtcc
cagaacggaggcgaaccttacttccatgcggttgaaccctacacgaagaaagaactttct
gctgttactttccctgacatcattcgcaattacaaagtcatggctgctgagaatattcct
gagaatcccctgaagtatttgtatccaaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccggagccaatggaacttgatggccctaaaggaactgga
tatatcaagactgaattgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcctgaggagtttgacgaggtgtctcggatagtgggctct
gtagaattcgacagtatgatgaacgcagtatag

DBGET integrated database retrieval system