KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528119
Entry
108528119         CDS       T04641                                 

Gene name
ITGAM
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04145  Phagosome
rbb04514  Cell adhesion molecules
rbb04610  Complement and coagulation cascades
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04670  Leukocyte transendothelial migration
rbb04810  Regulation of actin cytoskeleton
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05202  Transcriptional misregulation in cancer
rbb05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108528119 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108528119 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108528119 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108528119 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108528119 (ITGAM)
   04610 Complement and coagulation cascades
    108528119 (ITGAM)
   04613 Neutrophil extracellular trap formation
    108528119 (ITGAM)
   04670 Leukocyte transendothelial migration
    108528119 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108528119 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108528119 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108528119 (ITGAM)
   05134 Legionellosis
    108528119 (ITGAM)
   05150 Staphylococcus aureus infection
    108528119 (ITGAM)
   05152 Tuberculosis
    108528119 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108528119 (ITGAM)
   05140 Leishmaniasis
    108528119 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108528119 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108528119 (ITGAM)
   04515 Cell adhesion molecules [BR:rbb04515]
    108528119 (ITGAM)
   04090 CD molecules [BR:rbb04090]
    108528119 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108528119 (ITGAM)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108528119 (ITGAM)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108528119 (ITGAM)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108528119 (ITGAM)
CD molecules [BR:rbb04090]
 Proteins
  108528119 (ITGAM)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   108528119 (ITGAM)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 108528119
NCBI-ProteinID: XP_017725308
UniProt: A0A2K6MHZ2
LinkDB
Position
Un
AA seq 1152 aa
MALRVLLLTALTLCHGFNLDTENAMTFQENAKGFGQSVVQLQGSRVVVGAPQEIVAANQT
GSLYQCDYSIGLCEPIRLQIPVEAVNMSLGLSLAATTSPPQLLACGPTMHQICSENTYVK
GLCFLFGSNLRQQPQKFPGTLRGCPEQDIAFLIDGSGSINPHEFQQMKEFVSIMMEQLKK
STTLFSLMQYSEEFWTHFTFKEFQGNPNPRSLVKSITQLFGRTHTATAIRKVVRELFNVN
QGARKNALKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSLKSRQELNT
IASKPPRDHVFQVNNFEALKTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSAAITSN
GPLLSTVGSYDWAGGAFLYTSKEKSTFINMTRVDSDMNDAYLGYAATVILRNRVQNLVLG
APRYQHVGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGNTDLVLIGAPHY
YEQTRGGQVSVCPLPRGQRGRWQCDAVLYGEQGQLWGRFGAALTVLGDVNGDKLTDVAIG
APGEEDNQGAVYLFHGTSGFGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDL
TVGAQGHVLLFRSQPVLRVEATMEFNPREVARNVFECNDQMVKGKEAGEVRVCLRVQKST
RDRLREGQIQSVVTYDLALDSGRPHSRAVFGETKNSTRRQTKTLGLTQTCETLKLQLPDC
IEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFIASFPFEKNCGNDSICQDDLS
ITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLGLSYRKVSRLQNQRSQR
SWRLACESASSTEVPGTLKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANV
TSENNMSRTNKTEFQRELPVKYAVYMVVTSHEVSTKYLNFTASENTSRVMQHQYQVSNLG
QRSLPISLEFSVPVRLNQTIIWDRPQVTFSESLSSTCHTKERFPTPHTDFLAKLRKDPVV
NCSIAVCQIIRCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLVVSTAEILFNNSTFT
LLPGQGAFVKAQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atggctctcagagtccttctgttaacagccttgaccttatgtcatgggttcaacctggac
actgaaaacgcaatgaccttccaagagaacgcaaagggcttcgggcagagcgtggtccag
cttcagggatccagggtggtggttggagccccccaggagatagtggctgccaaccaaacg
ggcagcctctaccagtgtgattacagcataggcttatgcgagcccatccgcctgcagatc
cccgtggaggccgtgaacatgtccctgggcctgtctctggcagccaccaccagccccccc
cagctgctggcctgtggccccaccatgcaccagatttgcagtgagaacacgtatgtgaaa
gggctctgcttcctgttcggatccaacctacggcagcagccccagaagttcccagggacc
ctccgagggtgtcctgaacaggacatcgccttcttgattgacggctctggtagcatcaac
ccacatgaatttcagcagatgaaggagtttgtctcgatcatgatggagcaattaaaaaag
tccacaaccttgttctctttgatgcagtactccgaagaattctggactcattttaccttc
aaagagttccagggcaaccctaacccgagatcactggtgaagtcaataacgcagctgttt
gggcggacacacacggccacggccatccgcaaagtggtacgagaactgtttaacgtcaat
cagggagcccgaaagaatgcccttaagatcctggttgtcatcacagatggagaaaagttt
ggcgatcccttgggatatgaggacgtcatccctgaggcagacagagagggagtcattcgc
tacgtcattggggtgggagacgccttccgcagtttgaaatcccgccaagagcttaatacc
attgcatccaagccacctcgtgatcacgtgttccaagtgaataactttgaggctctgaag
accattcagaaccagcttcaggagaagatctttgcaattgagggtactcagacaggaagt
accagctcctttgagcatgagatgtctcaggaaggcttcagtgctgccatcacctctaac
ggccccttgctgagcactgtagggagctatgactgggctggtggagcctttctatataca
tcaaaggagaaaagcaccttcatcaacatgaccagagtggattcagacatgaatgatgct
tacttgggttatgctgccaccgtcatcttgcggaaccgggtgcaaaacctggttctgggg
gcacctcgatatcagcacgtcggcctggtggcaatgttcaggcagaacactggcatgtgg
gagtccaacgccaatgtcaagggcacccagatcggcgcctacttcggggcctccctctgc
tccgtggatgtggacagcaacggcaacaccgacctggtcctcatcggggccccccattac
tacgagcagacccgagggggccaggtgtctgtgtgccccttgccccgggggcagaggggt
cggtggcagtgtgatgctgttctctacggggagcagggccaactctggggccgctttgga
gcagccctaacagtgctgggggacgtgaatggggacaagctgacggatgtggccattggg
gccccaggagaggaggacaaccagggtgctgtttatctgtttcatggaacctcaggattt
ggcatcagcccctcccatagccagcggatagcaggctccaagctctctcccaggctccag
tattttggtcagtcactgagtggggggcaggacctcacaatggatggactggtggacctg
actgtaggagcccaggggcacgtgctgttgttcaggtcccagccagtactgagagtcgag
gcaactatggagttcaatcccagggaagtggcaaggaatgtatttgagtgtaatgatcag
atggtgaaaggcaaggaagctggggaggtcagagtctgcctccgtgtccagaagagcaca
cgggatcgactaagagaagggcagatccagagtgttgtgacttacgacctggctctggac
tccggccgcccacattcccgcgctgtctttggtgagacaaagaacagcacgcgcaggcag
acgaagaccttggggctgacccagacttgtgagaccctgaagctacagttgccggattgc
atcgaggacccagtgagccccattgtgctgcgcctgaacttctctctggtgggaactccc
ttgtctgctttcgggaacctccggccagtgctggctgaggatgctcagagactcttcata
gcctcatttccctttgagaagaattgtggcaatgacagcatttgccaggatgacctcagc
atcaccttcagtttcatgagcctggactgcctcgtggtgggtgggccccgggagttcaac
gtgacagtgactgtgagaaatgacggcgaggactcctataggacacaggtcaccttcttc
ttcccgcttggcctgtcctaccggaaggtgtccaggctccagaaccagcgctcacagaga
tcctggcgcctggcctgtgagtctgcctcctccaccgaagtgcctgggaccttgaagagc
accagctgcagcataaaccaccccatcttcccagaaaactcagaggtcacctttaatatc
acatttgatgtggactctaaggcttcccttggaaacaaactgctcctcaaggccaatgtg
accagtgagaacaacatgtccagaaccaacaaaaccgaattccaacgggagctgccggtg
aaatatgctgtctacatggtggtcaccagccatgaggtctccactaaatatctcaacttc
acggcctcagagaataccagtcgcgtcatgcagcatcaatatcaggtcagcaacctgggg
cagaggagcctccccatcagcctggagttctcggtgcccgtccggctgaaccagacgatc
atatgggaccgcccccaggtcaccttctccgagagcctctcgagtacgtgccacaccaag
gaaagatttcccacccctcacaccgactttctggctaagcttcggaaggacccagtggtg
aactgctccatcgctgtctgccagataatccggtgtgacatcccgttctttggcatccag
gaagaattcaatgccaccctcaaaggcaacctctcgtttgactggtacatcaagacctcg
cataaccacctcctggtcgtgagcacagctgagatcttgtttaacaattccacgttcacc
ctgcttccgggacagggggcttttgtgaaggcccagacggagaccaaagtggagccgttc
gaggtccccaaccccttgccgctcatcgtgggcagctctgtgggggggttgctgctcttg
gccctcatcaccgctgcgctgtacaagctcggcttcttcaagcggcagtacaaggacatg
atgagtgaagggggtcccccgggggccgaaccccagtag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539787
Entry
108539787         CDS       T04641                                 

Gene name
ITGB2
Definition
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04145  Phagosome
rbb04390  Hippo signaling pathway
rbb04514  Cell adhesion molecules
rbb04610  Complement and coagulation cascades
rbb04613  Neutrophil extracellular trap formation
rbb04650  Natural killer cell mediated cytotoxicity
rbb04670  Leukocyte transendothelial migration
rbb04810  Regulation of actin cytoskeleton
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05144  Malaria
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05166  Human T-cell leukemia virus 1 infection
rbb05323  Rheumatoid arthritis
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108539787 (ITGB2)
   04390 Hippo signaling pathway
    108539787 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108539787 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108539787 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108539787 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    108539787 (ITGB2)
   04613 Neutrophil extracellular trap formation
    108539787 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    108539787 (ITGB2)
   04670 Leukocyte transendothelial migration
    108539787 (ITGB2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    108539787 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108539787 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108539787 (ITGB2)
   05134 Legionellosis
    108539787 (ITGB2)
   05150 Staphylococcus aureus infection
    108539787 (ITGB2)
   05152 Tuberculosis
    108539787 (ITGB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108539787 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108539787 (ITGB2)
   05144 Malaria
    108539787 (ITGB2)
   05140 Leishmaniasis
    108539787 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108539787 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108539787 (ITGB2)
   04515 Cell adhesion molecules [BR:rbb04515]
    108539787 (ITGB2)
   04090 CD molecules [BR:rbb04090]
    108539787 (ITGB2)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108539787 (ITGB2)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108539787 (ITGB2)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin beta subunits
   108539787 (ITGB2)
CD molecules [BR:rbb04090]
 Proteins
  108539787 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 108539787
NCBI-ProteinID: XP_017744170
LinkDB
Position
Un
AA seq 768 aa
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGQGIXLIR
CDTRPQLLMRGCPADDIMDPRSLAETQEDXQWGPEELSPQKVTLDLRPGQAAEFTVTFRR
AKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVN
THPDKLRNPCPDKEKECQAPFAFRHVLKLTSNSNQFQREVGKQLISGNLDAPEGGLDAMM
QVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDY
PSVGQLAHKLAENNIQPIFAVTRKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYN
KLSSRVFLDHNALPDTLKVTYDSFCSNGVTLRDQSRGDCDGVQINVPVTFRVKVTATECI
QEQSFVIRALGFTDTVAVRVLPQCECRCRDLSRDRSFCHGKGFLECGICRCDTGYIGKTC
ECQTQGRSSQELEGSCRKDNNSVICSGLGDCVCGQCLCHTSDVPGKQIYGQYCECDNVNC
ERHNGQVCGGPGRGLCFCGECRCLQGFDGSACQCERTTEGCLNPQRVECSGRGRCRCNVC
ECKDNYQPPLCQECPGCPSPCGKHISCAECLKFDKGPFGKNCSAACRDLQLSNNPVKGRT
CKERDSEGCWVTYMLEQQDGWDRYIIYVDESRECMAGPNIAAIVGGTVAGIVLIGVLLLV
IWKALTHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgctgggcctgcgcccccctctgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggagtgcattgagtctggg
cccggctgcacctggtgccagaagctgaacttcacaggccaggggatctgactcattcgc
tgtgacacccggccacagctgctcatgaggggctgtcccgcagatgacattatggacccc
aggagcctcgccgaaacccaggaagacnngcaatgggggccagaagagctgtccccacaa
aaagtgactcttgacctgcgaccaggccaggcagcagagttcaccgtgaccttccggcgg
gccaagggctaccccatcgacctctactacctgatggacctctcctactccatgcttgac
gacctcaggaacgtcaagaagctgggtggcgacctgctccaggccctcaacgagatcacc
gagtccggccgcattggcttcgggtccttcgtagacaagaccgtgctgccgttcgtgaac
acacaccctgataagctgcgaaacccgtgtcctgacaaggagaaagagtgccaggccccg
tttgccttcaggcacgtgctgaagttgaccagcaactccaaccagtttcagagagaggtc
gggaagcagctgatttcaggaaacctggatgcacctgagggtgggctggacgccatgatg
caggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacacggctgctggtgttc
gccactgacgacggcttccacttcgcgggcgacgggaagctgggtgccatcctgaccccc
aatgatggccgctgtcacctggaggacaacatgtacaagaggagcaacgagttcgactac
ccatcggtgggccagctggcgcacaagctggccgagaacaacatccagcccatcttcgcg
gtgaccaggaagatggtgaagacctacgagaaactcactgagatcatcccgaagtcagcg
gtgggggagctgtctgacgactccagcaatgtggtccagctcattaagaacgcttacaat
aaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtcacc
tatgactccttctgcagcaatggagtgaccctcagggaccagtccagaggtgactgcgac
ggcgtgcagatcaatgtcccggtcaccttccgggtgaaggtcacggccacagagtgtatc
caggagcagtcgtttgtcatccgggcactgggcttcacggacactgtggccgtacgggtc
cttccccagtgtgagtgccggtgccgggacctgagcagggaccgcagcttctgccatggc
aagggcttcttggagtgtggcatctgcaggtgtgacactggctacattgggaaaacctgt
gagtgccagacgcagggccggagcagccaggagctggaaggaagctgccggaaggacaac
aactccgtcatctgctcagggctgggggactgcgtctgcgggcagtgtctgtgccacacc
agcgacgtccccggcaagcagatctacgggcagtactgcgaatgtgacaacgtcaactgt
gagcgccacaacggccaggtctgcggcggcccggggagggggctttgcttctgcggggag
tgccgctgcctccagggcttcgacggctcggcgtgccagtgcgagaggaccaccgagggc
tgcctgaacccacagcgcgtcgagtgcagcggccgtggccggtgccgctgcaacgtgtgt
gagtgcaaagacaattaccagccgcctctgtgccaggagtgccccggctgcccctcgccc
tgcggcaagcacatctcctgtgctgagtgcctgaagtttgacaaaggccctttcgggaag
aactgcagcgcagcgtgtcgggacctgcagctgtcgaacaaccctgtgaagggcaggacc
tgcaaggagagggattcagagggctgctgggtgacgtacatgctggagcagcaggacggg
tgggatcgctacatcatctatgtggatgagagccgagagtgcatggcgggccccaacatc
gccgccatcgtcgggggcactgtggcaggcatcgtgctgatcggcgtcctcctgctggtc
atctggaaggccctgacccacctgagcgacctccgggagtacaggcgttttgagaaggag
aagctcaagtcccagtggaacaacgataatccccttttcaagagcgccaccacgacggtc
atgaaccctaagtttgctgagagttag

DBGET integrated database retrieval system