KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528282
Entry
108528282         CDS       T04641                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04218  Cellular senescence
rbb04350  TGF-beta signaling pathway
rbb04380  Osteoclast differentiation
rbb04390  Hippo signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05410  Hypertrophic cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108528282 (TGFB2)
   04350 TGF-beta signaling pathway
    108528282 (TGFB2)
   04390 Hippo signaling pathway
    108528282 (TGFB2)
   04068 FoxO signaling pathway
    108528282 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108528282 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108528282 (TGFB2)
   04218 Cellular senescence
    108528282 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108528282 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528282 (TGFB2)
   05206 MicroRNAs in cancer
    108528282 (TGFB2)
   05205 Proteoglycans in cancer
    108528282 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108528282 (TGFB2)
   05212 Pancreatic cancer
    108528282 (TGFB2)
   05225 Hepatocellular carcinoma
    108528282 (TGFB2)
   05226 Gastric cancer
    108528282 (TGFB2)
   05220 Chronic myeloid leukemia
    108528282 (TGFB2)
   05211 Renal cell carcinoma
    108528282 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108528282 (TGFB2)
   05321 Inflammatory bowel disease
    108528282 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108528282 (TGFB2)
   05414 Dilated cardiomyopathy
    108528282 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108528282 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108528282 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108528282 (TGFB2)
   05161 Hepatitis B
    108528282 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108528282 (TGFB2)
   05144 Malaria
    108528282 (TGFB2)
   05145 Toxoplasmosis
    108528282 (TGFB2)
   05140 Leishmaniasis
    108528282 (TGFB2)
   05142 Chagas disease
    108528282 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108528282 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108528282 (TGFB2)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108528282 (TGFB2)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108528282 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 108528282
NCBI-ProteinID: XP_017725506
UniProt: A0A2K6JV81
LinkDB
Position
Un
AA seq 442 aa
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgttcggttt
gacgtctcagcaatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaatccaaaagccagagtgcctgaacaacggattgagctgtatcagattctc
aagtccaaagacttaacatctccaacccagcgctacattgacagcaaagttgtgaaaaca
agagcagaaggcgaatggctttccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagcttacattgtccctgctgcacttttgta
ccatctaataattacatcatcccaaataaaagcgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagaccaaccggcggaagaagcgtgctttggatgcggcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatctagggtgg
aaatggatacacgaacccaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ttatggagttcagacactcagcacagcagggtcctgagcttatataataccataaatcca
gaagcatctgcttctccttgctgcgtgtcccaagatttagaacctctaaccattctctac
tacattggcaaaacacccaagattgaacagctttctaatatgattgtaaagtcttgcaaa
tgcagctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534939
Entry
108534939         CDS       T04641                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04218  Cellular senescence
rbb04350  TGF-beta signaling pathway
rbb04390  Hippo signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05410  Hypertrophic cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108534939 (TGFB3)
   04350 TGF-beta signaling pathway
    108534939 (TGFB3)
   04390 Hippo signaling pathway
    108534939 (TGFB3)
   04068 FoxO signaling pathway
    108534939 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108534939 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108534939 (TGFB3)
   04218 Cellular senescence
    108534939 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108534939 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108534939 (TGFB3)
   05212 Pancreatic cancer
    108534939 (TGFB3)
   05225 Hepatocellular carcinoma
    108534939 (TGFB3)
   05226 Gastric cancer
    108534939 (TGFB3)
   05220 Chronic myeloid leukemia
    108534939 (TGFB3)
   05211 Renal cell carcinoma
    108534939 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108534939 (TGFB3)
   05321 Inflammatory bowel disease
    108534939 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108534939 (TGFB3)
   05414 Dilated cardiomyopathy
    108534939 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108534939 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108534939 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108534939 (TGFB3)
   05161 Hepatitis B
    108534939 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108534939 (TGFB3)
   05144 Malaria
    108534939 (TGFB3)
   05145 Toxoplasmosis
    108534939 (TGFB3)
   05140 Leishmaniasis
    108534939 (TGFB3)
   05142 Chagas disease
    108534939 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108534939 (TGFB3)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108534939 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 108534939
NCBI-ProteinID: XP_017736057
UniProt: A0A2K6LSK0
LinkDB
Position
Un
AA seq 412 aa
MKMHLQRALVVLALLNFASVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggcactgctgaactttgcctcggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccccaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccggatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacacagtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccacggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagagaaagaagcgg
gccttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaggtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536158
Entry
108536158         CDS       T04641                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04218  Cellular senescence
rbb04350  TGF-beta signaling pathway
rbb04380  Osteoclast differentiation
rbb04390  Hippo signaling pathway
rbb04659  Th17 cell differentiation
rbb04672  Intestinal immune network for IgA production
rbb04926  Relaxin signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05410  Hypertrophic cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108536158 (TGFB1)
   04350 TGF-beta signaling pathway
    108536158 (TGFB1)
   04390 Hippo signaling pathway
    108536158 (TGFB1)
   04068 FoxO signaling pathway
    108536158 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108536158 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108536158 (TGFB1)
   04218 Cellular senescence
    108536158 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108536158 (TGFB1)
   04672 Intestinal immune network for IgA production
    108536158 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108536158 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108536158 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108536158 (TGFB1)
   05205 Proteoglycans in cancer
    108536158 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108536158 (TGFB1)
   05212 Pancreatic cancer
    108536158 (TGFB1)
   05225 Hepatocellular carcinoma
    108536158 (TGFB1)
   05226 Gastric cancer
    108536158 (TGFB1)
   05220 Chronic myeloid leukemia
    108536158 (TGFB1)
   05211 Renal cell carcinoma
    108536158 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108536158 (TGFB1)
   05321 Inflammatory bowel disease
    108536158 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108536158 (TGFB1)
   05414 Dilated cardiomyopathy
    108536158 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108536158 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108536158 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108536158 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108536158 (TGFB1)
   05161 Hepatitis B
    108536158 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108536158 (TGFB1)
   05144 Malaria
    108536158 (TGFB1)
   05145 Toxoplasmosis
    108536158 (TGFB1)
   05140 Leishmaniasis
    108536158 (TGFB1)
   05142 Chagas disease
    108536158 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rbb03110]
    108536158 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108536158 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108536158 (TGFB1)
Chaperones and folding catalysts [BR:rbb03110]
 Intramolecular chaperones
  Others
   108536158 (TGFB1)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108536158 (TGFB1)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108536158 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 108536158
NCBI-ProteinID: XP_017738192
UniProt: A0A2K6K6F3
LinkDB
Position
Un
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNQLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccaagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcggagccggagcccgaaccggag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagcacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcagtacctgaacctgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcatgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccagctgctggcgcccagcgactcgccggagtggttgtcttttgatgtc
accggagttgtgcggcagtggttgagccgcggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcaaagataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccaacatctgcaaagctcccggcaccgccgagccctg
gacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctgtatatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccacgccaac
ttctgcctggggccctgcccctacatttggagcctggacacccagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaaatgcagctga

DBGET integrated database retrieval system