Rhinopithecus bieti (black snub-nosed monkey): 108528326 Help Entry 108528326         CDS       T04641                                  Gene name MAPK14 Definition (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb01522   Endocrine resistance rbb04010   MAPK signaling pathway rbb04015   Rap1 signaling pathway rbb04068   FoxO signaling pathway rbb04071   Sphingolipid signaling pathway rbb04114   Oocyte meiosis rbb04218   Cellular senescence rbb04261   Adrenergic signaling in cardiomyocytes rbb04370   VEGF signaling pathway rbb04380   Osteoclast differentiation rbb04550   Signaling pathways regulating pluripotency of stem cells rbb04611   Platelet activation rbb04620   Toll-like receptor signaling pathway rbb04621   NOD-like receptor signaling pathway rbb04622   RIG-I-like receptor signaling pathway rbb04625   C-type lectin receptor signaling pathway rbb04657   IL-17 signaling pathway rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04660   T cell receptor signaling pathway rbb04664   Fc epsilon RI signaling pathway rbb04668   TNF signaling pathway rbb04670   Leukocyte transendothelial migration rbb04714   Thermogenesis rbb04722   Neurotrophin signaling pathway rbb04723   Retrograde endocannabinoid signaling rbb04728   Dopaminergic synapse rbb04750   Inflammatory mediator regulation of TRP channels rbb04912   GnRH signaling pathway rbb04914   Progesterone-mediated oocyte maturation rbb04917   Prolactin signaling pathway rbb04926   Relaxin signaling pathway rbb04933   AGE-RAGE signaling pathway in diabetic complications rbb04935   Growth hormone synthesis, secretion and action rbb05014   Amyotrophic lateral sclerosis rbb05020   Prion disease rbb05022   Pathways of neurodegeneration - multiple diseases rbb05132   Salmonella infection rbb05133   Pertussis rbb05135   Yersinia infection rbb05140   Leishmaniasis rbb05142   Chagas disease rbb05145   Toxoplasmosis rbb05152   Tuberculosis rbb05161   Hepatitis B rbb05163   Human cytomegalovirus infection rbb05167   Kaposi sarcoma-associated herpesvirus infection rbb05169   Epstein-Barr virus infection rbb05170   Human immunodeficiency virus 1 infection rbb05171   Coronavirus disease - COVID-19 rbb05205   Proteoglycans in cancer rbb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rbb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108528326 (MAPK14)    04015 Rap1 signaling pathway     108528326 (MAPK14)    04370 VEGF signaling pathway     108528326 (MAPK14)    04668 TNF signaling pathway     108528326 (MAPK14)    04068 FoxO signaling pathway     108528326 (MAPK14)    04071 Sphingolipid signaling pathway     108528326 (MAPK14)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108528326 (MAPK14)    04218 Cellular senescence     108528326 (MAPK14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108528326 (MAPK14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108528326 (MAPK14)    04620 Toll-like receptor signaling pathway     108528326 (MAPK14)    04621 NOD-like receptor signaling pathway     108528326 (MAPK14)    04622 RIG-I-like receptor signaling pathway     108528326 (MAPK14)    04625 C-type lectin receptor signaling pathway     108528326 (MAPK14)    04660 T cell receptor signaling pathway     108528326 (MAPK14)    04658 Th1 and Th2 cell differentiation     108528326 (MAPK14)    04659 Th17 cell differentiation     108528326 (MAPK14)    04657 IL-17 signaling pathway     108528326 (MAPK14)    04664 Fc epsilon RI signaling pathway     108528326 (MAPK14)    04670 Leukocyte transendothelial migration     108528326 (MAPK14)   09152 Endocrine system    04912 GnRH signaling pathway     108528326 (MAPK14)    04914 Progesterone-mediated oocyte maturation     108528326 (MAPK14)    04917 Prolactin signaling pathway     108528326 (MAPK14)    04926 Relaxin signaling pathway     108528326 (MAPK14)    04935 Growth hormone synthesis, secretion and action     108528326 (MAPK14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108528326 (MAPK14)   09156 Nervous system    04728 Dopaminergic synapse     108528326 (MAPK14)    04723 Retrograde endocannabinoid signaling     108528326 (MAPK14)    04722 Neurotrophin signaling pathway     108528326 (MAPK14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108528326 (MAPK14)   09158 Development and regeneration    04380 Osteoclast differentiation     108528326 (MAPK14)   09159 Environmental adaptation    04714 Thermogenesis     108528326 (MAPK14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108528326 (MAPK14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108528326 (MAPK14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108528326 (MAPK14)    05020 Prion disease     108528326 (MAPK14)    05022 Pathways of neurodegeneration - multiple diseases     108528326 (MAPK14)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108528326 (MAPK14)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108528326 (MAPK14)   09171 Infectious disease: bacterial    05132 Salmonella infection     108528326 (MAPK14)    05135 Yersinia infection     108528326 (MAPK14)    05133 Pertussis     108528326 (MAPK14)    05152 Tuberculosis     108528326 (MAPK14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108528326 (MAPK14)    05161 Hepatitis B     108528326 (MAPK14)    05171 Coronavirus disease - COVID-19     108528326 (MAPK14)    05163 Human cytomegalovirus infection     108528326 (MAPK14)    05167 Kaposi sarcoma-associated herpesvirus infection     108528326 (MAPK14)    05169 Epstein-Barr virus infection     108528326 (MAPK14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108528326 (MAPK14)    05140 Leishmaniasis     108528326 (MAPK14)    05142 Chagas disease     108528326 (MAPK14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108528326 (MAPK14)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rbb01001]     108528326 (MAPK14) Enzymes [BR:rbb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108528326 (MAPK14) Protein kinases [BR:rbb01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108528326 (MAPK14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like Motif Other DBs NCBI-GeneID:  108528326 NCBI-ProteinID:  XP_017725572 UniProt:  A0A2K6LWM6 LinkDB All DBs Position Un AA seq 360 aa AA seqDB search MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgct gcttttgacacaaaaacagggttacgtgtggcagtgaagaagctctccagaccatttcag tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat gaaaatgttattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat atacattcagctgacatcattcacagggacctaaaacctagtaatctagctgtgaatgaa gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg acctatgatgaagtcgtcagctttgtgccaccgcccctcgaccaagaagagatggagtcc tga

Rhinopithecus bieti (black snub-nosed monkey): 108528327 Help Entry 108528327         CDS       T04641                                  Gene name MAPK13 Definition (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb01522   Endocrine resistance rbb04010   MAPK signaling pathway rbb04015   Rap1 signaling pathway rbb04068   FoxO signaling pathway rbb04071   Sphingolipid signaling pathway rbb04114   Oocyte meiosis rbb04218   Cellular senescence rbb04261   Adrenergic signaling in cardiomyocytes rbb04370   VEGF signaling pathway rbb04380   Osteoclast differentiation rbb04550   Signaling pathways regulating pluripotency of stem cells rbb04611   Platelet activation rbb04620   Toll-like receptor signaling pathway rbb04621   NOD-like receptor signaling pathway rbb04622   RIG-I-like receptor signaling pathway rbb04625   C-type lectin receptor signaling pathway rbb04657   IL-17 signaling pathway rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04660   T cell receptor signaling pathway rbb04664   Fc epsilon RI signaling pathway rbb04668   TNF signaling pathway rbb04670   Leukocyte transendothelial migration rbb04714   Thermogenesis rbb04722   Neurotrophin signaling pathway rbb04723   Retrograde endocannabinoid signaling rbb04728   Dopaminergic synapse rbb04750   Inflammatory mediator regulation of TRP channels rbb04912   GnRH signaling pathway rbb04914   Progesterone-mediated oocyte maturation rbb04917   Prolactin signaling pathway rbb04926   Relaxin signaling pathway rbb04933   AGE-RAGE signaling pathway in diabetic complications rbb04935   Growth hormone synthesis, secretion and action rbb05014   Amyotrophic lateral sclerosis rbb05020   Prion disease rbb05022   Pathways of neurodegeneration - multiple diseases rbb05132   Salmonella infection rbb05133   Pertussis rbb05135   Yersinia infection rbb05140   Leishmaniasis rbb05142   Chagas disease rbb05145   Toxoplasmosis rbb05152   Tuberculosis rbb05161   Hepatitis B rbb05163   Human cytomegalovirus infection rbb05167   Kaposi sarcoma-associated herpesvirus infection rbb05169   Epstein-Barr virus infection rbb05170   Human immunodeficiency virus 1 infection rbb05171   Coronavirus disease - COVID-19 rbb05205   Proteoglycans in cancer rbb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rbb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108528327 (MAPK13)    04015 Rap1 signaling pathway     108528327 (MAPK13)    04370 VEGF signaling pathway     108528327 (MAPK13)    04668 TNF signaling pathway     108528327 (MAPK13)    04068 FoxO signaling pathway     108528327 (MAPK13)    04071 Sphingolipid signaling pathway     108528327 (MAPK13)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108528327 (MAPK13)    04218 Cellular senescence     108528327 (MAPK13)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108528327 (MAPK13)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108528327 (MAPK13)    04620 Toll-like receptor signaling pathway     108528327 (MAPK13)    04621 NOD-like receptor signaling pathway     108528327 (MAPK13)    04622 RIG-I-like receptor signaling pathway     108528327 (MAPK13)    04625 C-type lectin receptor signaling pathway     108528327 (MAPK13)    04660 T cell receptor signaling pathway     108528327 (MAPK13)    04658 Th1 and Th2 cell differentiation     108528327 (MAPK13)    04659 Th17 cell differentiation     108528327 (MAPK13)    04657 IL-17 signaling pathway     108528327 (MAPK13)    04664 Fc epsilon RI signaling pathway     108528327 (MAPK13)    04670 Leukocyte transendothelial migration     108528327 (MAPK13)   09152 Endocrine system    04912 GnRH signaling pathway     108528327 (MAPK13)    04914 Progesterone-mediated oocyte maturation     108528327 (MAPK13)    04917 Prolactin signaling pathway     108528327 (MAPK13)    04926 Relaxin signaling pathway     108528327 (MAPK13)    04935 Growth hormone synthesis, secretion and action     108528327 (MAPK13)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108528327 (MAPK13)   09156 Nervous system    04728 Dopaminergic synapse     108528327 (MAPK13)    04723 Retrograde endocannabinoid signaling     108528327 (MAPK13)    04722 Neurotrophin signaling pathway     108528327 (MAPK13)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108528327 (MAPK13)   09158 Development and regeneration    04380 Osteoclast differentiation     108528327 (MAPK13)   09159 Environmental adaptation    04714 Thermogenesis     108528327 (MAPK13)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108528327 (MAPK13)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108528327 (MAPK13)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108528327 (MAPK13)    05020 Prion disease     108528327 (MAPK13)    05022 Pathways of neurodegeneration - multiple diseases     108528327 (MAPK13)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108528327 (MAPK13)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108528327 (MAPK13)   09171 Infectious disease: bacterial    05132 Salmonella infection     108528327 (MAPK13)    05135 Yersinia infection     108528327 (MAPK13)    05133 Pertussis     108528327 (MAPK13)    05152 Tuberculosis     108528327 (MAPK13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108528327 (MAPK13)    05161 Hepatitis B     108528327 (MAPK13)    05171 Coronavirus disease - COVID-19     108528327 (MAPK13)    05163 Human cytomegalovirus infection     108528327 (MAPK13)    05167 Kaposi sarcoma-associated herpesvirus infection     108528327 (MAPK13)    05169 Epstein-Barr virus infection     108528327 (MAPK13)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108528327 (MAPK13)    05140 Leishmaniasis     108528327 (MAPK13)    05142 Chagas disease     108528327 (MAPK13)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108528327 (MAPK13)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rbb01001]     108528327 (MAPK13) Enzymes [BR:rbb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108528327 (MAPK13) Protein kinases [BR:rbb01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108528327 (MAPK13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023 FTA2 Motif Other DBs NCBI-GeneID:  108528327 NCBI-ProteinID:  XP_017725577 UniProt:  A0A2K6MB45 LinkDB All DBs Position Un AA seq 365 aa AA seqDB search MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDQRSGEKVAIKKLSRPF QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHANAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGTEFVQKLNDKAAKSYIQSLPQTPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAA QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR SGMKL NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt atgagcctcatccggaaaaagggattctacaagcaggacgtcaacaagaccgcctgggag ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgccgtgtgc tcggccatcgaccagcggtcaggggagaaggtggccatcaagaagctgagccggcccttt cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag catgagaacgtcattggtctcctggatgtcttcaccccagcctcctccctgcgcaacttc catgacttctacctggtgatgcccttcatgcagacagatttgcagaagatcatggggatg gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac atccactcagctggggtcgtgcacagggacctgaagccaggcaacctagctgtgaatgag gactgtgaactgaagatcctggattttgggctggcgcggcacgcaaatgccgagatgact ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg gtgccaggcacagagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag tccctgccacagacccccaagaaggatttcactcagctcttcccgcgggccagcccccag gccgtggacctgctggagaagatgctggagctagatgtggacaagcgcctgacagccgcg caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc caacagccatttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactcgcggcgccgg agtggcatgaagctgtag

Rhinopithecus bieti (black snub-nosed monkey): 108539403 Help Entry 108539403         CDS       T04641                                  Gene name MAPK12 Definition (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb01522   Endocrine resistance rbb04010   MAPK signaling pathway rbb04015   Rap1 signaling pathway rbb04068   FoxO signaling pathway rbb04071   Sphingolipid signaling pathway rbb04114   Oocyte meiosis rbb04218   Cellular senescence rbb04261   Adrenergic signaling in cardiomyocytes rbb04370   VEGF signaling pathway rbb04380   Osteoclast differentiation rbb04550   Signaling pathways regulating pluripotency of stem cells rbb04611   Platelet activation rbb04620   Toll-like receptor signaling pathway rbb04621   NOD-like receptor signaling pathway rbb04622   RIG-I-like receptor signaling pathway rbb04625   C-type lectin receptor signaling pathway rbb04657   IL-17 signaling pathway rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04660   T cell receptor signaling pathway rbb04664   Fc epsilon RI signaling pathway rbb04668   TNF signaling pathway rbb04670   Leukocyte transendothelial migration rbb04714   Thermogenesis rbb04722   Neurotrophin signaling pathway rbb04723   Retrograde endocannabinoid signaling rbb04728   Dopaminergic synapse rbb04750   Inflammatory mediator regulation of TRP channels rbb04912   GnRH signaling pathway rbb04914   Progesterone-mediated oocyte maturation rbb04917   Prolactin signaling pathway rbb04926   Relaxin signaling pathway rbb04933   AGE-RAGE signaling pathway in diabetic complications rbb04935   Growth hormone synthesis, secretion and action rbb05014   Amyotrophic lateral sclerosis rbb05020   Prion disease rbb05022   Pathways of neurodegeneration - multiple diseases rbb05132   Salmonella infection rbb05133   Pertussis rbb05135   Yersinia infection rbb05140   Leishmaniasis rbb05142   Chagas disease rbb05145   Toxoplasmosis rbb05152   Tuberculosis rbb05161   Hepatitis B rbb05163   Human cytomegalovirus infection rbb05167   Kaposi sarcoma-associated herpesvirus infection rbb05169   Epstein-Barr virus infection rbb05170   Human immunodeficiency virus 1 infection rbb05171   Coronavirus disease - COVID-19 rbb05205   Proteoglycans in cancer rbb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rbb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108539403 (MAPK12)    04015 Rap1 signaling pathway     108539403 (MAPK12)    04370 VEGF signaling pathway     108539403 (MAPK12)    04668 TNF signaling pathway     108539403 (MAPK12)    04068 FoxO signaling pathway     108539403 (MAPK12)    04071 Sphingolipid signaling pathway     108539403 (MAPK12)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108539403 (MAPK12)    04218 Cellular senescence     108539403 (MAPK12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108539403 (MAPK12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108539403 (MAPK12)    04620 Toll-like receptor signaling pathway     108539403 (MAPK12)    04621 NOD-like receptor signaling pathway     108539403 (MAPK12)    04622 RIG-I-like receptor signaling pathway     108539403 (MAPK12)    04625 C-type lectin receptor signaling pathway     108539403 (MAPK12)    04660 T cell receptor signaling pathway     108539403 (MAPK12)    04658 Th1 and Th2 cell differentiation     108539403 (MAPK12)    04659 Th17 cell differentiation     108539403 (MAPK12)    04657 IL-17 signaling pathway     108539403 (MAPK12)    04664 Fc epsilon RI signaling pathway     108539403 (MAPK12)    04670 Leukocyte transendothelial migration     108539403 (MAPK12)   09152 Endocrine system    04912 GnRH signaling pathway     108539403 (MAPK12)    04914 Progesterone-mediated oocyte maturation     108539403 (MAPK12)    04917 Prolactin signaling pathway     108539403 (MAPK12)    04926 Relaxin signaling pathway     108539403 (MAPK12)    04935 Growth hormone synthesis, secretion and action     108539403 (MAPK12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108539403 (MAPK12)   09156 Nervous system    04728 Dopaminergic synapse     108539403 (MAPK12)    04723 Retrograde endocannabinoid signaling     108539403 (MAPK12)    04722 Neurotrophin signaling pathway     108539403 (MAPK12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108539403 (MAPK12)   09158 Development and regeneration    04380 Osteoclast differentiation     108539403 (MAPK12)   09159 Environmental adaptation    04714 Thermogenesis     108539403 (MAPK12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108539403 (MAPK12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108539403 (MAPK12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108539403 (MAPK12)    05020 Prion disease     108539403 (MAPK12)    05022 Pathways of neurodegeneration - multiple diseases     108539403 (MAPK12)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108539403 (MAPK12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108539403 (MAPK12)   09171 Infectious disease: bacterial    05132 Salmonella infection     108539403 (MAPK12)    05135 Yersinia infection     108539403 (MAPK12)    05133 Pertussis     108539403 (MAPK12)    05152 Tuberculosis     108539403 (MAPK12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108539403 (MAPK12)    05161 Hepatitis B     108539403 (MAPK12)    05171 Coronavirus disease - COVID-19     108539403 (MAPK12)    05163 Human cytomegalovirus infection     108539403 (MAPK12)    05167 Kaposi sarcoma-associated herpesvirus infection     108539403 (MAPK12)    05169 Epstein-Barr virus infection     108539403 (MAPK12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108539403 (MAPK12)    05140 Leishmaniasis     108539403 (MAPK12)    05142 Chagas disease     108539403 (MAPK12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108539403 (MAPK12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rbb01001]     108539403 (MAPK12) Enzymes [BR:rbb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108539403 (MAPK12) Protein kinases [BR:rbb01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108539403 (MAPK12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Motif Other DBs NCBI-GeneID:  108539403 NCBI-ProteinID:  XP_017743539 LinkDB All DBs Position Un AA seq 419 aa AA seqDB search MSSPPPARSGFYRRGGDARRPGRGGAAVYRDLQPLGRGQPHRRQGGHQEAVSALPVRAVR QARLPRAAPAQTHASREQLLQASLGPCHPKMLRQQLSHDLSTVHLPNQGCCGDQVIGLLD VFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIH RVSPGGGASHQPSPSAIPCLHVLPDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVT RWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAE FVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAAEALAH PYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETAL NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt atgagctctccgccgcctgcccgcagtggcttttaccgccgaggaggtgacgcaagacgg cctgggaggggtggcgcggccgtgtaccgggacctgcagccgctcggccgtggacagccg caccggcgccaaggtggccatcaagaagctgtatcggcccttccagtccgagctgttcgc caagcgcgcctaccgcgagctgcgcctgctcaaacacatgcgtcacgagaacaactcctc caggcctccctgggaccctgtcaccccaaaatgctgaggcagcagttatcacatgaccta tccactgtccatctccccaaccaggggtgctgtggggaccaggtgattgggctgctggac gtattcactcctgatgagaccctggatgacttcacagacttttacctggtgatgccattc atgggcaccgacctgggcaagctcatgaaacatgagaagctgggcgaggaccggatccag ttcctcgtgtaccagatgctgaaggggttgaggtatatccatgctgccggcatcatccac agagtgagtcctggtggaggagccagccatcagccctcccccagcgcaatcccctgcctc cacgtcctacctgacctgaagcctggcaacctggctgtgaacgaagactgtgagctgaag atcctggactttggcctggccaggcaagcagacagtgagatgactgggtatgtggtgacc cggtggtaccgggcacccgaggtcatcttgaattggatgcgctacacgcagacggtggac atctggtctgtgggctgcatcatggcggagatgatcacaggcaagacgctgttcaagggc agcgaccacctggaccagctgaaggagatcatgaaggtgacagggacgcctccagctgag tttgtgcagcggctgcagagtgatgaggccaagaactacatgaagggcctccccgagttg gagaagaaggattttgcctccatcctgaccaatgcaagccctctggctgtgaacctcctg gagaagatgctggtgctggatgcggagcagcgggtgacagcagccgaggcactggcccat ccctacttcgagtccctgcacgacacagaagatgagccccaggtccagaagtatgacgac tcctttgatgacgtggaccgcacgctggatgaatggaagcgtgttacttacaaagaggtg ctcagcttcaagcctccccggcagctgggagccagggtctccaaggagacggctctgtga

Rhinopithecus bieti (black snub-nosed monkey): 108539422 Help Entry 108539422         CDS       T04641                                  Gene name MAPK11 Definition (RefSeq) mitogen-activated protein kinase 11   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rbb  Rhinopithecus bieti (black snub-nosed monkey) Pathway rbb01522   Endocrine resistance rbb04010   MAPK signaling pathway rbb04015   Rap1 signaling pathway rbb04068   FoxO signaling pathway rbb04071   Sphingolipid signaling pathway rbb04114   Oocyte meiosis rbb04218   Cellular senescence rbb04261   Adrenergic signaling in cardiomyocytes rbb04370   VEGF signaling pathway rbb04380   Osteoclast differentiation rbb04550   Signaling pathways regulating pluripotency of stem cells rbb04611   Platelet activation rbb04620   Toll-like receptor signaling pathway rbb04621   NOD-like receptor signaling pathway rbb04622   RIG-I-like receptor signaling pathway rbb04625   C-type lectin receptor signaling pathway rbb04657   IL-17 signaling pathway rbb04658   Th1 and Th2 cell differentiation rbb04659   Th17 cell differentiation rbb04660   T cell receptor signaling pathway rbb04664   Fc epsilon RI signaling pathway rbb04668   TNF signaling pathway rbb04670   Leukocyte transendothelial migration rbb04714   Thermogenesis rbb04722   Neurotrophin signaling pathway rbb04723   Retrograde endocannabinoid signaling rbb04728   Dopaminergic synapse rbb04750   Inflammatory mediator regulation of TRP channels rbb04912   GnRH signaling pathway rbb04914   Progesterone-mediated oocyte maturation rbb04917   Prolactin signaling pathway rbb04926   Relaxin signaling pathway rbb04933   AGE-RAGE signaling pathway in diabetic complications rbb04935   Growth hormone synthesis, secretion and action rbb05014   Amyotrophic lateral sclerosis rbb05020   Prion disease rbb05022   Pathways of neurodegeneration - multiple diseases rbb05132   Salmonella infection rbb05133   Pertussis rbb05135   Yersinia infection rbb05140   Leishmaniasis rbb05142   Chagas disease rbb05145   Toxoplasmosis rbb05152   Tuberculosis rbb05161   Hepatitis B rbb05163   Human cytomegalovirus infection rbb05167   Kaposi sarcoma-associated herpesvirus infection rbb05169   Epstein-Barr virus infection rbb05170   Human immunodeficiency virus 1 infection rbb05171   Coronavirus disease - COVID-19 rbb05205   Proteoglycans in cancer rbb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rbb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rbb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108539422 (MAPK11)    04015 Rap1 signaling pathway     108539422 (MAPK11)    04370 VEGF signaling pathway     108539422 (MAPK11)    04668 TNF signaling pathway     108539422 (MAPK11)    04068 FoxO signaling pathway     108539422 (MAPK11)    04071 Sphingolipid signaling pathway     108539422 (MAPK11)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108539422 (MAPK11)    04218 Cellular senescence     108539422 (MAPK11)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108539422 (MAPK11)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108539422 (MAPK11)    04620 Toll-like receptor signaling pathway     108539422 (MAPK11)    04621 NOD-like receptor signaling pathway     108539422 (MAPK11)    04622 RIG-I-like receptor signaling pathway     108539422 (MAPK11)    04625 C-type lectin receptor signaling pathway     108539422 (MAPK11)    04660 T cell receptor signaling pathway     108539422 (MAPK11)    04658 Th1 and Th2 cell differentiation     108539422 (MAPK11)    04659 Th17 cell differentiation     108539422 (MAPK11)    04657 IL-17 signaling pathway     108539422 (MAPK11)    04664 Fc epsilon RI signaling pathway     108539422 (MAPK11)    04670 Leukocyte transendothelial migration     108539422 (MAPK11)   09152 Endocrine system    04912 GnRH signaling pathway     108539422 (MAPK11)    04914 Progesterone-mediated oocyte maturation     108539422 (MAPK11)    04917 Prolactin signaling pathway     108539422 (MAPK11)    04926 Relaxin signaling pathway     108539422 (MAPK11)    04935 Growth hormone synthesis, secretion and action     108539422 (MAPK11)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108539422 (MAPK11)   09156 Nervous system    04728 Dopaminergic synapse     108539422 (MAPK11)    04723 Retrograde endocannabinoid signaling     108539422 (MAPK11)    04722 Neurotrophin signaling pathway     108539422 (MAPK11)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108539422 (MAPK11)   09158 Development and regeneration    04380 Osteoclast differentiation     108539422 (MAPK11)   09159 Environmental adaptation    04714 Thermogenesis     108539422 (MAPK11)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108539422 (MAPK11)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108539422 (MAPK11)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108539422 (MAPK11)    05020 Prion disease     108539422 (MAPK11)    05022 Pathways of neurodegeneration - multiple diseases     108539422 (MAPK11)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108539422 (MAPK11)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108539422 (MAPK11)   09171 Infectious disease: bacterial    05132 Salmonella infection     108539422 (MAPK11)    05135 Yersinia infection     108539422 (MAPK11)    05133 Pertussis     108539422 (MAPK11)    05152 Tuberculosis     108539422 (MAPK11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108539422 (MAPK11)    05161 Hepatitis B     108539422 (MAPK11)    05171 Coronavirus disease - COVID-19     108539422 (MAPK11)    05163 Human cytomegalovirus infection     108539422 (MAPK11)    05167 Kaposi sarcoma-associated herpesvirus infection     108539422 (MAPK11)    05169 Epstein-Barr virus infection     108539422 (MAPK11)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108539422 (MAPK11)    05140 Leishmaniasis     108539422 (MAPK11)    05142 Chagas disease     108539422 (MAPK11)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108539422 (MAPK11)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rbb01001]     108539422 (MAPK11) Enzymes [BR:rbb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108539422 (MAPK11) Protein kinases [BR:rbb01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108539422 (MAPK11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like Motif Other DBs NCBI-GeneID:  108539422 NCBI-ProteinID:  XP_017743602 UniProt:  A0A2K6MF86 LinkDB All DBs Position Un AA seq 364 aa AA seqDB search MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFHGANPLAIDLLGRMLVLDSDQRVSAA EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL EIEQ NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg ccgcagcggctgcaggggctgcgcccggtgggctcgggcgcctacggctccgtctgttcg gcctacgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag tcgctgatccacgcgcgcaggacgtaccgggagctgcggctgctcaagcacctgaagcac gagaacgtcatcgggcttctggacgtcttcacgccggccacgtctatcgaggacttcagc gaagtgtacttggtgaccaccctcatgggcgccgacctgaacaacatcgtcaagtgccag gcgctgagcgacgagcacgttcagttcctggtttaccaactgctgcgcgggctaaagtac atccactcggcggggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag gactgtgagctcaggatcctggacttcgggctggcgcgccaggcggacgaggagatgacc ggctatgtggccacgcgctggtaccgggcacctgagatcatgctaaactggatgcattac aaccagacagtggacatctggtccgtgggctgcatcatggctgagctgctccagggcaag gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc acacccagccccgaggttctggcaaagatctcctcagaacacgcccggacatatatccag tccctgccccccatgccccagaaggacctgagcagcatcttccatggagccaaccccctg gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgccgcc gaggcactggcccacgcctacttcagccagtaccacgaccctgaggatgagccagaggcc gagccgtatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc acctaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg gagattgagcagtga

DBGET integrated database retrieval system