KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528326
Entry
108528326         CDS       T04641                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04015  Rap1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04114  Oocyte meiosis
rbb04218  Cellular senescence
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05014  Amyotrophic lateral sclerosis
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05205  Proteoglycans in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108528326 (MAPK14)
   04015 Rap1 signaling pathway
    108528326 (MAPK14)
   04370 VEGF signaling pathway
    108528326 (MAPK14)
   04668 TNF signaling pathway
    108528326 (MAPK14)
   04068 FoxO signaling pathway
    108528326 (MAPK14)
   04071 Sphingolipid signaling pathway
    108528326 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108528326 (MAPK14)
   04218 Cellular senescence
    108528326 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108528326 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108528326 (MAPK14)
   04620 Toll-like receptor signaling pathway
    108528326 (MAPK14)
   04621 NOD-like receptor signaling pathway
    108528326 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    108528326 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    108528326 (MAPK14)
   04660 T cell receptor signaling pathway
    108528326 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    108528326 (MAPK14)
   04659 Th17 cell differentiation
    108528326 (MAPK14)
   04657 IL-17 signaling pathway
    108528326 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    108528326 (MAPK14)
   04670 Leukocyte transendothelial migration
    108528326 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108528326 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    108528326 (MAPK14)
   04917 Prolactin signaling pathway
    108528326 (MAPK14)
   04926 Relaxin signaling pathway
    108528326 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    108528326 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108528326 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    108528326 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    108528326 (MAPK14)
   04722 Neurotrophin signaling pathway
    108528326 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108528326 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108528326 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    108528326 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108528326 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108528326 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108528326 (MAPK14)
   05020 Prion disease
    108528326 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    108528326 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108528326 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108528326 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108528326 (MAPK14)
   05135 Yersinia infection
    108528326 (MAPK14)
   05133 Pertussis
    108528326 (MAPK14)
   05152 Tuberculosis
    108528326 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108528326 (MAPK14)
   05161 Hepatitis B
    108528326 (MAPK14)
   05171 Coronavirus disease - COVID-19
    108528326 (MAPK14)
   05163 Human cytomegalovirus infection
    108528326 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108528326 (MAPK14)
   05169 Epstein-Barr virus infection
    108528326 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108528326 (MAPK14)
   05140 Leishmaniasis
    108528326 (MAPK14)
   05142 Chagas disease
    108528326 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108528326 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108528326 (MAPK14)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108528326 (MAPK14)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108528326 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 108528326
NCBI-ProteinID: XP_017725572
UniProt: A0A2K6LWM6
LinkDB
Position
Un
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacagggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgttattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacatcattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcgtcagctttgtgccaccgcccctcgaccaagaagagatggagtcc
tga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528327
Entry
108528327         CDS       T04641                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04015  Rap1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04114  Oocyte meiosis
rbb04218  Cellular senescence
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05014  Amyotrophic lateral sclerosis
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05205  Proteoglycans in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108528327 (MAPK13)
   04015 Rap1 signaling pathway
    108528327 (MAPK13)
   04370 VEGF signaling pathway
    108528327 (MAPK13)
   04668 TNF signaling pathway
    108528327 (MAPK13)
   04068 FoxO signaling pathway
    108528327 (MAPK13)
   04071 Sphingolipid signaling pathway
    108528327 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108528327 (MAPK13)
   04218 Cellular senescence
    108528327 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108528327 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108528327 (MAPK13)
   04620 Toll-like receptor signaling pathway
    108528327 (MAPK13)
   04621 NOD-like receptor signaling pathway
    108528327 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    108528327 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    108528327 (MAPK13)
   04660 T cell receptor signaling pathway
    108528327 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    108528327 (MAPK13)
   04659 Th17 cell differentiation
    108528327 (MAPK13)
   04657 IL-17 signaling pathway
    108528327 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    108528327 (MAPK13)
   04670 Leukocyte transendothelial migration
    108528327 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108528327 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    108528327 (MAPK13)
   04917 Prolactin signaling pathway
    108528327 (MAPK13)
   04926 Relaxin signaling pathway
    108528327 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    108528327 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108528327 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    108528327 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    108528327 (MAPK13)
   04722 Neurotrophin signaling pathway
    108528327 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108528327 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108528327 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    108528327 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108528327 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108528327 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108528327 (MAPK13)
   05020 Prion disease
    108528327 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    108528327 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108528327 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108528327 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108528327 (MAPK13)
   05135 Yersinia infection
    108528327 (MAPK13)
   05133 Pertussis
    108528327 (MAPK13)
   05152 Tuberculosis
    108528327 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108528327 (MAPK13)
   05161 Hepatitis B
    108528327 (MAPK13)
   05171 Coronavirus disease - COVID-19
    108528327 (MAPK13)
   05163 Human cytomegalovirus infection
    108528327 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108528327 (MAPK13)
   05169 Epstein-Barr virus infection
    108528327 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108528327 (MAPK13)
   05140 Leishmaniasis
    108528327 (MAPK13)
   05142 Chagas disease
    108528327 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108528327 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108528327 (MAPK13)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108528327 (MAPK13)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108528327 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023 FTA2
Other DBs
NCBI-GeneID: 108528327
NCBI-ProteinID: XP_017725577
UniProt: A0A2K6MB45
LinkDB
Position
Un
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDQRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHANAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggattctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgccgtgtgc
tcggccatcgaccagcggtcaggggagaaggtggccatcaagaagctgagccggcccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattggtctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacagatttgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac
atccactcagctggggtcgtgcacagggacctgaagccaggcaacctagctgtgaatgag
gactgtgaactgaagatcctggattttgggctggcgcggcacgcaaatgccgagatgact
ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgccaggcacagagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaagaaggatttcactcagctcttcccgcgggccagcccccag
gccgtggacctgctggagaagatgctggagctagatgtggacaagcgcctgacagccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
caacagccatttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactcgcggcgccgg
agtggcatgaagctgtag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539403
Entry
108539403         CDS       T04641                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04015  Rap1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04114  Oocyte meiosis
rbb04218  Cellular senescence
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05014  Amyotrophic lateral sclerosis
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05205  Proteoglycans in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108539403 (MAPK12)
   04015 Rap1 signaling pathway
    108539403 (MAPK12)
   04370 VEGF signaling pathway
    108539403 (MAPK12)
   04668 TNF signaling pathway
    108539403 (MAPK12)
   04068 FoxO signaling pathway
    108539403 (MAPK12)
   04071 Sphingolipid signaling pathway
    108539403 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108539403 (MAPK12)
   04218 Cellular senescence
    108539403 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108539403 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108539403 (MAPK12)
   04620 Toll-like receptor signaling pathway
    108539403 (MAPK12)
   04621 NOD-like receptor signaling pathway
    108539403 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    108539403 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    108539403 (MAPK12)
   04660 T cell receptor signaling pathway
    108539403 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    108539403 (MAPK12)
   04659 Th17 cell differentiation
    108539403 (MAPK12)
   04657 IL-17 signaling pathway
    108539403 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    108539403 (MAPK12)
   04670 Leukocyte transendothelial migration
    108539403 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108539403 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    108539403 (MAPK12)
   04917 Prolactin signaling pathway
    108539403 (MAPK12)
   04926 Relaxin signaling pathway
    108539403 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    108539403 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108539403 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    108539403 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    108539403 (MAPK12)
   04722 Neurotrophin signaling pathway
    108539403 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108539403 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108539403 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    108539403 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108539403 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108539403 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108539403 (MAPK12)
   05020 Prion disease
    108539403 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    108539403 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108539403 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108539403 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108539403 (MAPK12)
   05135 Yersinia infection
    108539403 (MAPK12)
   05133 Pertussis
    108539403 (MAPK12)
   05152 Tuberculosis
    108539403 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108539403 (MAPK12)
   05161 Hepatitis B
    108539403 (MAPK12)
   05171 Coronavirus disease - COVID-19
    108539403 (MAPK12)
   05163 Human cytomegalovirus infection
    108539403 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108539403 (MAPK12)
   05169 Epstein-Barr virus infection
    108539403 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108539403 (MAPK12)
   05140 Leishmaniasis
    108539403 (MAPK12)
   05142 Chagas disease
    108539403 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108539403 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108539403 (MAPK12)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108539403 (MAPK12)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108539403 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 108539403
NCBI-ProteinID: XP_017743539
LinkDB
Position
Un
AA seq 419 aa
MSSPPPARSGFYRRGGDARRPGRGGAAVYRDLQPLGRGQPHRRQGGHQEAVSALPVRAVR
QARLPRAAPAQTHASREQLLQASLGPCHPKMLRQQLSHDLSTVHLPNQGCCGDQVIGLLD
VFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIH
RVSPGGGASHQPSPSAIPCLHVLPDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVT
RWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAE
FVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAAEALAH
PYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETAL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcctgcccgcagtggcttttaccgccgaggaggtgacgcaagacgg
cctgggaggggtggcgcggccgtgtaccgggacctgcagccgctcggccgtggacagccg
caccggcgccaaggtggccatcaagaagctgtatcggcccttccagtccgagctgttcgc
caagcgcgcctaccgcgagctgcgcctgctcaaacacatgcgtcacgagaacaactcctc
caggcctccctgggaccctgtcaccccaaaatgctgaggcagcagttatcacatgaccta
tccactgtccatctccccaaccaggggtgctgtggggaccaggtgattgggctgctggac
gtattcactcctgatgagaccctggatgacttcacagacttttacctggtgatgccattc
atgggcaccgacctgggcaagctcatgaaacatgagaagctgggcgaggaccggatccag
ttcctcgtgtaccagatgctgaaggggttgaggtatatccatgctgccggcatcatccac
agagtgagtcctggtggaggagccagccatcagccctcccccagcgcaatcccctgcctc
cacgtcctacctgacctgaagcctggcaacctggctgtgaacgaagactgtgagctgaag
atcctggactttggcctggccaggcaagcagacagtgagatgactgggtatgtggtgacc
cggtggtaccgggcacccgaggtcatcttgaattggatgcgctacacgcagacggtggac
atctggtctgtgggctgcatcatggcggagatgatcacaggcaagacgctgttcaagggc
agcgaccacctggaccagctgaaggagatcatgaaggtgacagggacgcctccagctgag
tttgtgcagcggctgcagagtgatgaggccaagaactacatgaagggcctccccgagttg
gagaagaaggattttgcctccatcctgaccaatgcaagccctctggctgtgaacctcctg
gagaagatgctggtgctggatgcggagcagcgggtgacagcagccgaggcactggcccat
ccctacttcgagtccctgcacgacacagaagatgagccccaggtccagaagtatgacgac
tcctttgatgacgtggaccgcacgctggatgaatggaagcgtgttacttacaaagaggtg
ctcagcttcaagcctccccggcagctgggagccagggtctccaaggagacggctctgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539422
Entry
108539422         CDS       T04641                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04015  Rap1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04114  Oocyte meiosis
rbb04218  Cellular senescence
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05014  Amyotrophic lateral sclerosis
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05205  Proteoglycans in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108539422 (MAPK11)
   04015 Rap1 signaling pathway
    108539422 (MAPK11)
   04370 VEGF signaling pathway
    108539422 (MAPK11)
   04668 TNF signaling pathway
    108539422 (MAPK11)
   04068 FoxO signaling pathway
    108539422 (MAPK11)
   04071 Sphingolipid signaling pathway
    108539422 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108539422 (MAPK11)
   04218 Cellular senescence
    108539422 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108539422 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108539422 (MAPK11)
   04620 Toll-like receptor signaling pathway
    108539422 (MAPK11)
   04621 NOD-like receptor signaling pathway
    108539422 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    108539422 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    108539422 (MAPK11)
   04660 T cell receptor signaling pathway
    108539422 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    108539422 (MAPK11)
   04659 Th17 cell differentiation
    108539422 (MAPK11)
   04657 IL-17 signaling pathway
    108539422 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    108539422 (MAPK11)
   04670 Leukocyte transendothelial migration
    108539422 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108539422 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    108539422 (MAPK11)
   04917 Prolactin signaling pathway
    108539422 (MAPK11)
   04926 Relaxin signaling pathway
    108539422 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    108539422 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108539422 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    108539422 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    108539422 (MAPK11)
   04722 Neurotrophin signaling pathway
    108539422 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108539422 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108539422 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    108539422 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108539422 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108539422 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108539422 (MAPK11)
   05020 Prion disease
    108539422 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    108539422 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108539422 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108539422 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108539422 (MAPK11)
   05135 Yersinia infection
    108539422 (MAPK11)
   05133 Pertussis
    108539422 (MAPK11)
   05152 Tuberculosis
    108539422 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108539422 (MAPK11)
   05161 Hepatitis B
    108539422 (MAPK11)
   05171 Coronavirus disease - COVID-19
    108539422 (MAPK11)
   05163 Human cytomegalovirus infection
    108539422 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108539422 (MAPK11)
   05169 Epstein-Barr virus infection
    108539422 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108539422 (MAPK11)
   05140 Leishmaniasis
    108539422 (MAPK11)
   05142 Chagas disease
    108539422 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108539422 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108539422 (MAPK11)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108539422 (MAPK11)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108539422 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 108539422
NCBI-ProteinID: XP_017743602
UniProt: A0A2K6MF86
LinkDB
Position
Un
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctcgggcgcctacggctccgtctgttcg
gcctacgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcaggacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtctatcgaggacttcagc
gaagtgtacttggtgaccaccctcatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcagttcctggtttaccaactgctgcgcgggctaaagtac
atccactcggcggggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggacttcgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctaaactggatgcattac
aaccagacagtggacatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccccgaggttctggcaaagatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccatggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgccgcc
gaggcactggcccacgcctacttcagccagtaccacgaccctgaggatgagccagaggcc
gagccgtatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

DBGET integrated database retrieval system