KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528336
Entry
108528336         CDS       T04641                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04630  JAK-STAT signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108528336 (CDKN1A)
   04630 JAK-STAT signaling pathway
    108528336 (CDKN1A)
   04066 HIF-1 signaling pathway
    108528336 (CDKN1A)
   04068 FoxO signaling pathway
    108528336 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    108528336 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108528336 (CDKN1A)
   04115 p53 signaling pathway
    108528336 (CDKN1A)
   04218 Cellular senescence
    108528336 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108528336 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    108528336 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528336 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    108528336 (CDKN1A)
   05206 MicroRNAs in cancer
    108528336 (CDKN1A)
   05205 Proteoglycans in cancer
    108528336 (CDKN1A)
   05203 Viral carcinogenesis
    108528336 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108528336 (CDKN1A)
   05212 Pancreatic cancer
    108528336 (CDKN1A)
   05225 Hepatocellular carcinoma
    108528336 (CDKN1A)
   05226 Gastric cancer
    108528336 (CDKN1A)
   05214 Glioma
    108528336 (CDKN1A)
   05216 Thyroid cancer
    108528336 (CDKN1A)
   05220 Chronic myeloid leukemia
    108528336 (CDKN1A)
   05217 Basal cell carcinoma
    108528336 (CDKN1A)
   05218 Melanoma
    108528336 (CDKN1A)
   05211 Renal cell carcinoma
    108528336 (CDKN1A)
   05219 Bladder cancer
    108528336 (CDKN1A)
   05215 Prostate cancer
    108528336 (CDKN1A)
   05213 Endometrial cancer
    108528336 (CDKN1A)
   05224 Breast cancer
    108528336 (CDKN1A)
   05222 Small cell lung cancer
    108528336 (CDKN1A)
   05223 Non-small cell lung cancer
    108528336 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108528336 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108528336 (CDKN1A)
   05161 Hepatitis B
    108528336 (CDKN1A)
   05160 Hepatitis C
    108528336 (CDKN1A)
   05163 Human cytomegalovirus infection
    108528336 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108528336 (CDKN1A)
   05169 Epstein-Barr virus infection
    108528336 (CDKN1A)
   05165 Human papillomavirus infection
    108528336 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108528336 (CDKN1A)
   01522 Endocrine resistance
    108528336 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108528336
NCBI-ProteinID: XP_017725595
LinkDB
Position
Un
AA seq 163 aa
MSEQAGTVRXEPCGKQGCRRLFGPVTASRLSHCDALMAGCIQEARERWNFDFVTETPLEG
DFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVP
RSGEQPEESPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtcagaacaggctgggactgtccgtnccgaaccatgcggcaagcaaggctgccgccgc
ctctttggaccggtgacagcgagcagactgagccactgtgatgcgctaatggcgggctgt
atccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggagggt
gacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacaggg
ccccggcggggccgggatgagttgggaggaggcaggcggcctggcacctcgcctgctctg
ctgcaggggacagcagaggaagaccatgtggacctgtcgctatcttgtacccttgtgcct
cgctcaggggagcagcctgaagagtccccaggtggacctggagactctcagggtcgaaaa
cggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctccaag
aggaagccctaa

DBGET integrated database retrieval system