KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528465
Entry
108528465         CDS       T04641                                 

Gene name
RBX1
Definition
(RefSeq) ring-box 1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03420  Nucleotide excision repair
rbb04066  HIF-1 signaling pathway
rbb04110  Cell cycle
rbb04114  Oocyte meiosis
rbb04120  Ubiquitin mediated proteolysis
rbb04141  Protein processing in endoplasmic reticulum
rbb04310  Wnt signaling pathway
rbb04350  TGF-beta signaling pathway
rbb04710  Circadian rhythm
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108528465 (RBX1)
   04120 Ubiquitin mediated proteolysis
    108528465 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    108528465 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108528465 (RBX1)
   04350 TGF-beta signaling pathway
    108528465 (RBX1)
   04066 HIF-1 signaling pathway
    108528465 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108528465 (RBX1)
   04114 Oocyte meiosis
    108528465 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    108528465 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528465 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108528465 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108528465 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108528465 (RBX1)
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108528465 (RBX1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     108528465 (RBX1)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   108528465 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     108528465 (RBX1)
   ECV complex
     108528465 (RBX1)
   Cul3 complex
     108528465 (RBX1)
   Cul4 complex
     108528465 (RBX1)
   Cul7 complex
     108528465 (RBX1)
   Cul9 complex
     108528465 (RBX1)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      108528465 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      108528465 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 108528465
NCBI-ProteinID: XP_017725765
UniProt: A0A2K6MYW8
LinkDB
Position
Un
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcatctgctacttcagaagaatgtaccgtcgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag
tgggaattccaaaagtacgggcactag

DBGET integrated database retrieval system