KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528761
Entry
108528761         CDS       T04641                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04110  Cell cycle
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04310  Wnt signaling pathway
rbb04350  TGF-beta signaling pathway
rbb04390  Hippo signaling pathway
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04630  JAK-STAT signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb05132  Salmonella infection
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05213  Endometrial cancer
rbb05216  Thyroid cancer
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108528761 (MYC)
   04012 ErbB signaling pathway
    108528761 (MYC)
   04310 Wnt signaling pathway
    108528761 (MYC)
   04350 TGF-beta signaling pathway
    108528761 (MYC)
   04390 Hippo signaling pathway
    108528761 (MYC)
   04630 JAK-STAT signaling pathway
    108528761 (MYC)
   04151 PI3K-Akt signaling pathway
    108528761 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108528761 (MYC)
   04218 Cellular senescence
    108528761 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108528761 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108528761 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528761 (MYC)
   05202 Transcriptional misregulation in cancer
    108528761 (MYC)
   05206 MicroRNAs in cancer
    108528761 (MYC)
   05205 Proteoglycans in cancer
    108528761 (MYC)
   05230 Central carbon metabolism in cancer
    108528761 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108528761 (MYC)
   05225 Hepatocellular carcinoma
    108528761 (MYC)
   05226 Gastric cancer
    108528761 (MYC)
   05216 Thyroid cancer
    108528761 (MYC)
   05221 Acute myeloid leukemia
    108528761 (MYC)
   05220 Chronic myeloid leukemia
    108528761 (MYC)
   05219 Bladder cancer
    108528761 (MYC)
   05213 Endometrial cancer
    108528761 (MYC)
   05224 Breast cancer
    108528761 (MYC)
   05222 Small cell lung cancer
    108528761 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108528761 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108528761 (MYC)
   05161 Hepatitis B
    108528761 (MYC)
   05160 Hepatitis C
    108528761 (MYC)
   05163 Human cytomegalovirus infection
    108528761 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108528761 (MYC)
   05169 Epstein-Barr virus infection
    108528761 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108528761 (MYC)
   03019 Messenger RNA biogenesis [BR:rbb03019]
    108528761 (MYC)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    108528761 (MYC)
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     108528761 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 108528761
NCBI-ProteinID: XP_017726235
LinkDB
Position
Un
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPVRGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVHAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcaacagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcccttc
tcccctcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcagagaagctagcctcctaccaggctgcgcgcaaagacagcggc
agcccgaaccctgtccgcggccacagcgtctgctccacctccagcttgtatctgcaggat
ctgagcgccgccgcctcggagtgcatcgacccctcagtggtctttccctaccctctcaac
gacagcagctcgcccaagtcctgcgcctcaccggactccagcgccttctcaccgtcctcg
gattctctgctctcctcgacggagtcctccccgcaggccagcccagagcccctggtgctc
catgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaagatgaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggcccctggcaaaaggtcagagtcagga
tcaccttctgctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaattacgcagcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcggacaccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccacgcagaggagcaaaagctcatttctgaaaaggatttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system