KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528921
Entry
108528921         CDS       T04641                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04640  Hematopoietic cell lineage
rbb04916  Melanogenesis
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108528921 (KITLG)
   04014 Ras signaling pathway
    108528921 (KITLG)
   04015 Rap1 signaling pathway
    108528921 (KITLG)
   04072 Phospholipase D signaling pathway
    108528921 (KITLG)
   04151 PI3K-Akt signaling pathway
    108528921 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108528921 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    108528921 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528921 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108528921 (KITLG)
Cytokines and growth factors [BR:rbb04052]
 Growth factors
  Growth factors (RTK binding)
   108528921 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 108528921
NCBI-ProteinID: XP_017726429
LinkDB
Position
Un
AA seq 283 aa
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLFVTQETTLKGRLSLGRA
RWLTPVIPTLWEAEPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDD
LVECVKENSSKGLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVISSTLS
PEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPAFFSLIIGF
AFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattgtttgtgacccaagaaacaacactaaaaggacgactgtctttgggccgggcg
cggtggctcacgcctgtaatcccaacactttgggaggccgagccaagtcattgttggata
agcgagatggtagtacaattgtcagacagcttgactgatcttctggacaagttttcaaat
atttctgaaggcttgagtaattattccatcatagacaaacttgtgaatatagtggatgac
cttgtggagtgtgtgaaagaaaactcatctaagggtctaaaaaaatcattcaagagccca
gaacccaggctctttactcctgaagaattctttagaatttttaatagatccattgatgcc
ttcaaggactttgtagtggcatctgaaactagtgattgtgtgatttcttcgacattaagt
cctgagaaagattccagagtcagtgtcacaaaaccatttatgttaccccctgttgcagcc
agctcccttaggaatgacagcagtagcagtaataggaaggccaaaaatccccctggagac
tccagcctacactgggcagccatggcattgccagcattcttttctcttataattggcttt
gcttttggagccttatactggaagaagagacagccaagtcttacaagggcagttgaaaat
atacaaattaatgaagaggataatgagataagtatgttgcaagagaaagagagagagttt
caagaagtgtaa

DBGET integrated database retrieval system