KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529199
Entry
108529199         CDS       T04641                                 

Gene name
EEF1A1
Definition
(RefSeq) eukaryotic translation elongation factor 1 alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03013  RNA transport
rbb05134  Legionellosis
rbb05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108529199 (EEF1A1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108529199 (EEF1A1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108529199 (EEF1A1)
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     108529199 (EEF1A1)
Transfer RNA biogenesis [BR:rbb03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    108529199 (EEF1A1)
Translation factors [BR:rbb03012]
 Eukaryotic type
  Elongation factors
   108529199 (EEF1A1)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    108529199 (EEF1A1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108529199 (EEF1A1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 108529199
NCBI-ProteinID: XP_017726824
UniProt: A0A2K6KG30
LinkDB
Position
Un
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggaaaagactcatatcaacattgtcgtcattggacacgtagattcgggcaag
tccaccactactggccatctgatctacaaatgcggtggcatcgacaaaagaaccattgaa
aaatttgagaaggaggctgctgagatgggaaagggctccttcaagtatgcctgggtcttg
gataaactgaaagctgagcgggaacgtggtatcaccattgatatctccttgtggaaattt
gagaccagcaagtattatgtgactatcattgacgccccaggacacagagacttcatcaaa
aacatgattacagggacatctcaggctgactgtgctgtcctaattgttgctgctggtgtt
ggtgaatttgaagctggtatctccaagaatgggcagacccgagagcatgctcttctggct
tacacactgggtgtgaaacaactaattgttggtgttaacaaaatggattccactgagcca
ccctacagccagaagagatacgaggaaattgttaaggaagtcagcacttacattaagaaa
attggctacaaccccgacacagtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaacatgccttggttcaagggatggaaggtcacccgtaaggat
ggcaatgccagtggaaccacgctgcttgaggctctggactgcatcctaccaccaactcgt
ccaactgacaagcccttgcgcctgcctctccaggatgtctacaaaattggtggtattggt
actgttcctgttggccgagtggagactggtgttctcaaacccggtatggtggtcaccttt
gctccagtcaacgtaacgactgaagtaaaatctgtcgaaatgcaccatgaagctttgagt
gaagctcttcctggggacaacgtgggctttaatgtcaagaatgtgtctgtcaaggatgtt
cgtcgtggcaacgttgctggtgacagcaaaaacgacccaccaatggaagcagctggcttc
actgctcaggtgattatcctgaaccatccaggccaaataagtgctggctatgcccctgtg
ttggattgccacacggctcacattgcatgcaagtttgctgagctgaaggaaaagattgat
cgccgttctggtaaaaaactggaagatggccctaaattcttgaagtctggtgatgctgcc
attgttgatatggttcctggcaagcctatgtgtgttgagagcttctcagactatccacct
ttgggtcgctttgctgttcgtgatatgaggcagacagttgcggtgggtgtcatcaaagca
gtggacaagaaggctgctggagctggcaaggtcaccaagtctgcccagaaagctcagaag
gctaaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535300
Entry
108535300         CDS       T04641                                 

Gene name
EEF1A2
Definition
(RefSeq) eukaryotic translation elongation factor 1 alpha 2
  KO
K03231  elongation factor 1-alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03013  RNA transport
rbb05134  Legionellosis
rbb05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108535300 (EEF1A2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108535300 (EEF1A2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108535300 (EEF1A2)
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     108535300 (EEF1A2)
Transfer RNA biogenesis [BR:rbb03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    108535300 (EEF1A2)
Translation factors [BR:rbb03012]
 Eukaryotic type
  Elongation factors
   108535300 (EEF1A2)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    108535300 (EEF1A2)
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108535300 (EEF1A2)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4
Other DBs
NCBI-GeneID: 108535300
NCBI-ProteinID: XP_017736722
UniProt: A0A2K6JTF2
LinkDB
Position
Un
AA seq 604 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPV
IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQEGGQVKRGRPAARPSRRCRAP
NPGRPPPRPRPARPRRPAPPARLHVCTSACRLPEALGQRLDARHQGPVEVLQEERRPRPR
LPRPALATLSARFTNKLSDPPEPCAPSAGGVGGPRPARAPRSPSTPGWPAQHLLPPAWGP
QGER
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgggcaaggagaagacccacatcaacatcgtggtcattggccatgtggactccggcaag
tccaccaccacaggccacctcatctacaagtgcgggggcatcgacaaaaggaccattgag
aagttcgagaaggaggcggctgagatggggaagggatccttcaagtatgcctgggtgctg
gacaagctgaaggcggagcgtgagcgcggcatcaccatcgatatctccctctggaagttc
gagaccaccaagtactacatcaccatcatcgatgcccccggccaccgtgacttcatcaag
aacatgatcacaggcacatcccaggcggactgcgcggtgctgatcgtggcggcgggcgtg
ggtgagttcgaggcgggcatctccaagaatgggcagacgcgggagcatgccctgctggcc
tacacgctgggtgtgaagcagctcatcgtgggcgtgaacaaaatggactccacggagcca
gcctacagtgagaagcgctatgatgagattgtcaaggaagtcagcgcctacatcaagaag
atcggctacaacccggccaccgtgcccttcgtgcccatctccggctggcacggcgacaac
atgctggagccctcccccaacatgccgtggttcaagggctggaaggtggagcgtaaggag
ggcaacgcaagcggcgtgtccctgctggaggccctggacaccatcctgccccccacgcgc
cccacggacaagcccctgcgcctgccactgcaggacgtgtacaagattggcggcattggt
acggtgcccgtgggccgggtggagacaggcatcctgcggccgggcatggtggtgaccttt
gcaccggtgaacatcaccactgaggtgaagtcggtggagatgcaccatgaggctctgagc
gaagctctgcccggtgacaacgttggcttcaatgtgaagaacgtgtcggtgaaggacatc
cggcggggcaacgtgtgtggggacagcaagtctgacccgccgcaggaggctgctcagttc
acctcccaggtcatcatcctgaaccacccggggcagatcagcgccggctactccccggtc
atcgactgccacacggcccacatcgcctgcaagtttgcggagctgaaggagaagattgac
cggcgctctggcaagaagctggaggacaaccccaagtccctgaagtctggagacgcggcc
attgtggagatggtgccgggaaagcccatgtgtgtggagagcttctcccagtacccgcct
ctcggccgtttcgccgtgcgcgacatgaggcagacggtggccgtgggcgtcatcaagaac
gtggagaagaagagcggcggcgccggcaaggtcaccaagtcggcgcagaaggcgcaggaa
ggcgggcaagtgaagcgcgggcggccggcggcgcgaccctcccggcggtgccgcgccccg
aaccccggccggcccccgccccgcccccgccccgcgcgcccccggcgccccgcacccccg
gccaggctgcatgtctgcacctccgcttgccgcttgccagaggccctcggtcagcgactg
gatgctcgccatcaaggtccagtggaagttcttcaagaggaaaggcgcccccgccccagg
cttccgcgcccagcgctcgccacgctcagtgcccgttttaccaataaactgagcgacccc
ccggagccgtgtgcgccttctgctgggggggtgggtgggccccgccccgcccgcgctccc
cggagcccctccacgcccgggtggccagcccagcatcttctaccccctgcctggggaccc
cagggtgagcgctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538073
Entry
108538073         CDS       T04641                                 

Definition
(RefSeq) elongation factor 1-alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03013  RNA transport
rbb05134  Legionellosis
rbb05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108538073
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108538073
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108538073
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     108538073
Transfer RNA biogenesis [BR:rbb03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    108538073
Translation factors [BR:rbb03012]
 Eukaryotic type
  Elongation factors
   108538073
Membrane trafficking [BR:rbb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    108538073
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108538073
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 108538073
NCBI-ProteinID: XP_017741409
UniProt: A0A2K6KG30
LinkDB
Position
Un
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggaaaagactcatatcaacattgtcgtcattggacacgtagattcgggcaag
tccaccactactggccatctgatctacaaatgcggtggcatcgacaaaagaaccattgaa
aaatttgagaaggaggctgctgagatgggaaagggctccttcaagtatgcctgggtcttg
gataaactgaaagctgagcgggaacgtggtatcaccattgatatctccttgtggaaattt
gagaccagcaagtattatgtgactatcattgacgccccaggacacagagacttcatcaaa
aacatgattacagggacatctcaggctgactgtgctgtcctaattgttgctgctggtgtt
ggtgaatttgaagctggtatctccaagaatgggcagacccgagagcatgctcttctggct
tacacactgggtgtgaaacaactaattgttggtgttaacaaaatggattccactgagcca
ccctacagccagaagagatacgaggaaattgttaaggaagtcagcacttacattaagaaa
attggctacaaccccgacacagtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaacatgccttggttcaagggatggaaggtcacccgtaaggat
ggcaatgccagtggaaccacgctgcttgaggctctggactgcatcctaccaccaactcgt
ccaactgacaagcccttgcgcctgcctctccaggatgtctacaaaattggtggtattggt
actgttcctgttggccgagtggagactggtgttctcaaacccggtatggtggtcaccttt
gctccagtcaacgtaacgactgaagtaaaatctgtcgaaatgcaccatgaagctttgagt
gaagctcttcctggggacaacgtgggctttaatgtcaagaatgtgtctgtcaaggatgtt
cgtcgtggcaacgttgctggtgacagcaaaaacgacccaccaatggaagcagctggcttc
actgctcaggtgattatcctgaaccatccaggccaaataagtgctggctatgcccctgtg
ttggattgccacacggctcacattgcatgcaagtttgctgagctgaaggaaaagattgat
cgccgttctggtaaaaaactggaagatggccctaaattcttgaagtctggtgatgctgcc
attgttgatatggttcctggcaagcctatgtgtgttgagagcttctcagactatccacct
ttgggtcgctttgctgttcgtgatatgaggcagacagttgcggtgggtgtcatcaaagca
gtggacaagaaggctgctggagctggcaaggtcaccaagtctgcccagaaagctcagaag
gctaaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541857
Entry
108541857         CDS       T04641                                 

Definition
(RefSeq) putative elongation factor 1-alpha-like 3
  KO
K03231  elongation factor 1-alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03013  RNA transport
rbb05134  Legionellosis
rbb05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108541857
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108541857
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108541857
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     108541857
Transfer RNA biogenesis [BR:rbb03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    108541857
Translation factors [BR:rbb03012]
 Eukaryotic type
  Elongation factors
   108541857
Membrane trafficking [BR:rbb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    108541857
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108541857
SSDB
Motif
Pfam: GTP_EFTU MMR_HSR1 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 108541857
NCBI-ProteinID: XP_017747064
LinkDB
Position
Un
AA seq 293 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTL
VRSLCVGHCAEGWPAEFLGIIPSGTHFYHFAQATATATSMGAATTASSGELLT
NT seq 880 nt   +upstreamnt  +downstreamnt
atgggaaaggaaaagactcatatcaacattgtcgtcattggacacgtagattcgggcaag
tccaccactactggccatctgatctacaaatgcggtggcatcgacaaaagaaccattgaa
aaatttgagaaggaggctgctgagatgggaaagggctccttcaagtatgcctgggtcttg
gataaactgaaagctgagcgggaacgtggtatcaccattgatatctccttgtggaaattt
gagaccagcaagtattatgtgactatcattgacgccccaggacacagagacttcatcaaa
aacatgattacagggacatctcaggctgactgtgctgtcctaattgttgctgctggtgtt
ggtgaatttgaagctggtatctccaagaatgggcagacccgagagcatgctcttctggct
tacacactgggtgtgaaacaactaattgttggtgttaacaaaatggattccactgagcca
ccctacagccagaagagatacgaggaaattgttaaggaagtcagcacttacattaagaaa
attggctacaaccccgacacagtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaacatgccttggttcaagggatggaaggtcacccgtaaggat
ggcaatgccagtggaaccacgctgcttgaggctctggactgcatcctaccaccaactctg
gtccggtcactctgtgtgggccactgtgcagagggctggccagcagaatttctaggtatt
attccttctggaacacatttttatcattttgctcaggccacggccactgccactagcatg
ggtgctgctactactgcctcctctggagagctgctcacag

DBGET integrated database retrieval system