KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529326
Entry
108529326         CDS       T04641                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01523  Antifolate resistance
rbb04060  Cytokine-cytokine receptor interaction
rbb04061  Viral protein interaction with cytokine and cytokine receptor
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04640  Hematopoietic cell lineage
rbb04657  IL-17 signaling pathway
rbb04659  Th17 cell differentiation
rbb04668  TNF signaling pathway
rbb04672  Intestinal immune network for IgA production
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05010  Alzheimer disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05332  Graft-versus-host disease
rbb05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108529326 (IL6)
   04668 TNF signaling pathway
    108529326 (IL6)
   04066 HIF-1 signaling pathway
    108529326 (IL6)
   04068 FoxO signaling pathway
    108529326 (IL6)
   04151 PI3K-Akt signaling pathway
    108529326 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108529326 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108529326 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108529326 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108529326 (IL6)
   04620 Toll-like receptor signaling pathway
    108529326 (IL6)
   04621 NOD-like receptor signaling pathway
    108529326 (IL6)
   04623 Cytosolic DNA-sensing pathway
    108529326 (IL6)
   04625 C-type lectin receptor signaling pathway
    108529326 (IL6)
   04659 Th17 cell differentiation
    108529326 (IL6)
   04657 IL-17 signaling pathway
    108529326 (IL6)
   04672 Intestinal immune network for IgA production
    108529326 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108529326 (IL6)
   05202 Transcriptional misregulation in cancer
    108529326 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108529326 (IL6)
   05321 Inflammatory bowel disease
    108529326 (IL6)
   05332 Graft-versus-host disease
    108529326 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108529326 (IL6)
   05020 Prion disease
    108529326 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    108529326 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108529326 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108529326 (IL6)
   04931 Insulin resistance
    108529326 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108529326 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108529326 (IL6)
   05135 Yersinia infection
    108529326 (IL6)
   05133 Pertussis
    108529326 (IL6)
   05134 Legionellosis
    108529326 (IL6)
   05152 Tuberculosis
    108529326 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108529326 (IL6)
   05161 Hepatitis B
    108529326 (IL6)
   05171 Coronavirus disease - COVID-19
    108529326 (IL6)
   05164 Influenza A
    108529326 (IL6)
   05162 Measles
    108529326 (IL6)
   05168 Herpes simplex virus 1 infection
    108529326 (IL6)
   05163 Human cytomegalovirus infection
    108529326 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108529326 (IL6)
   05169 Epstein-Barr virus infection
    108529326 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108529326 (IL6)
   05144 Malaria
    108529326 (IL6)
   05142 Chagas disease
    108529326 (IL6)
   05143 African trypanosomiasis
    108529326 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108529326 (IL6)
   01523 Antifolate resistance
    108529326 (IL6)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108529326 (IL6)
SSDB
Motif
Pfam: IL6 IL11 GCSF Phage_int_SAM_1
Other DBs
NCBI-GeneID: 108529326
NCBI-ProteinID: XP_017727047
LinkDB
Position
Un
AA seq 266 aa
MNSVSTSKCRKSLALERPAAVEPCVREGCVAQRGLAGGQQQRQAPSCAVSSRRRSLPSGT
GAFGPVAFSLGLLLVLPAAFPAPVLLGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISA
LRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL
EYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWL
QDMTTHLILRSFKEFLQSSLRALRQM
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagtaagtgcaggaaatccctagccctggaacggccagcggcg
gtcgagccctgtgtgagggaggggtgtgtggcccagcgagggctggcgggcggccagcag
cagaggcaggctcccagctgtgctgtcagctcacgccgccgctcgctcccctccggcaca
ggcgccttcggtccagttgccttctccctggggctgctcctggtgttgcctgctgccttc
cctgccccagtactcctaggagaagattccaaagatgtagccgccccacacagccagcca
ctgacctcttcagaacgaattgacaaacacattcggtacatcctcgacggcatctcagcc
ctgagaaaggagacatgtaacaggagtaacatgtgtgaaagcagcaaagaggcactggca
gaaaacaacctgaaccttccaaagatggctgaaaaagatggatgcttccaatctggattc
aatgaggagacttgcctggtgaaaatcatcactggtcttttggagtttgaggtataccta
gagtacctccagaacaggtttgagagcagtgaggaacaagccagagctgtgcagatgagt
acaaaagtcctgatccagttcctgcagaaaaaggcaaagaatctagatgcaataaccacc
cctgaaccaaccacaaatgccagcctgctgacgaagctgcaggcgcagaaccagtggctg
caggacatgacgacgcatctcatcctgcgcagctttaaggagttcctgcagtccagcctg
agggctcttcggcaaatgtaa

DBGET integrated database retrieval system