KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529400
Entry
108529400         CDS       T04641                                 

Gene name
ITGB1
Definition
(RefSeq) integrin subunit beta 1
  KO
K05719  integrin beta 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04360  Axon guidance
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04514  Cell adhesion molecules
rbb04530  Tight junction
rbb04611  Platelet activation
rbb04670  Leukocyte transendothelial migration
rbb04810  Regulation of actin cytoskeleton
rbb05100  Bacterial invasion of epithelial cells
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05145  Toxoplasmosis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108529400 (ITGB1)
   04151 PI3K-Akt signaling pathway
    108529400 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108529400 (ITGB1)
   04514 Cell adhesion molecules
    108529400 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108529400 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108529400 (ITGB1)
   04530 Tight junction
    108529400 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108529400 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108529400 (ITGB1)
   04670 Leukocyte transendothelial migration
    108529400 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    108529400 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108529400 (ITGB1)
   05205 Proteoglycans in cancer
    108529400 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108529400 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108529400 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108529400 (ITGB1)
   05414 Dilated cardiomyopathy
    108529400 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108529400 (ITGB1)
   05133 Pertussis
    108529400 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    108529400 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108529400 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108529400 (ITGB1)
   05140 Leishmaniasis
    108529400 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108529400 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108529400 (ITGB1)
   04515 Cell adhesion molecules [BR:rbb04515]
    108529400 (ITGB1)
   04090 CD molecules [BR:rbb04090]
    108529400 (ITGB1)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108529400 (ITGB1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108529400 (ITGB1)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin beta subunits
   108529400 (ITGB1)
CD molecules [BR:rbb04090]
 Proteins
  108529400 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 108529400
NCBI-ProteinID: XP_017727188
LinkDB
Position
Un
AA seq 798 aa
MNLQLIFWIGLISSICCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgatcagttccatttgctgtgtgtttggt
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcccact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttagag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttccgacttc
agaattggatttggttcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtctcactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaataatatgtacacaatgagtcattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaacttgatccctaagtcagcggtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggagtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgtcaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aacgggacgtttgagtgtggcgcgtgcaggtgcaacgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggacgcttactgcagaaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtttgtggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcgtgtgactgttctttggatactagtacttgcgaa
gccagcaacggacagatctgtaatggccggggcatctgcgaatgtggtgtctgtaagtgt
acagatccgaagttccaagggcaaacatgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgtgcacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccagtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacatattcagtgaatgggaacaatgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgattattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system