KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529583
Entry
108529583         CDS       T04641                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04151  PI3K-Akt signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04640  Hematopoietic cell lineage
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04672  Intestinal immune network for IgA production
rbb05140  Leishmaniasis
rbb05200  Pathways in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108529583 (IL4)
   04151 PI3K-Akt signaling pathway
    108529583 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108529583 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108529583 (IL4)
   04660 T cell receptor signaling pathway
    108529583 (IL4)
   04658 Th1 and Th2 cell differentiation
    108529583 (IL4)
   04659 Th17 cell differentiation
    108529583 (IL4)
   04657 IL-17 signaling pathway
    108529583 (IL4)
   04664 Fc epsilon RI signaling pathway
    108529583 (IL4)
   04672 Intestinal immune network for IgA production
    108529583 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108529583 (IL4)
  09163 Immune disease
   05310 Asthma
    108529583 (IL4)
   05320 Autoimmune thyroid disease
    108529583 (IL4)
   05321 Inflammatory bowel disease
    108529583 (IL4)
   05330 Allograft rejection
    108529583 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108529583 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108529583 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108529583 (IL4)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108529583 (IL4)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Haparin
  Cytokines
   108529583 (IL4)
SSDB
Motif
Pfam: IL4 IL13 Mannosyl_trans3
Other DBs
NCBI-GeneID: 108529583
NCBI-ProteinID: XP_017727511
UniProt: A0A2K6MWH2
LinkDB
Position
Un
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHNCHNALREIIETLNSLTEQKTLCTELTVTDILAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaactgccataacgccttacgggagatcatcgaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatccttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac
aagcagctgatccgattcctgaaacggctggacaggaacctctggggcctggcaggcttg
aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system