KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529980Help
Entry
108529980         CDS       T04641                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108529980 (TGM3)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108529980 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 108529980
NCBI-ProteinID: XP_017728029
LinkDB All DBs
Position
Un
AA seq 712 aa AA seqDB search
MKIRFRIKVVSALWCFYGGESALGLQSINWQTALNRQAHHTHKFSSQELILRRGQNFQVL
MLMNKGLGSSERLEFIVSTGPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISIS
SPASAPIGRYTMALQISSQGGISSVKLGTFILLFNPWLNADSVFMGNHAEREEYVQEDAG
IIYVGSTNRISMIGWNFGQFEEDILSICLSILDRSLNFRRDPATDVARRNDPKYVGRVLS
AMINSNDDNGVLAGNWSGTYTGGRDPRNWNGSVEILKDWKKSGFSPVRYGQCWVFAGTLN
TALRSLGIPSRVITNFSSAHDTDRNLSVDVYYDPMGNPLDRGSDSVWNFHVWNEGWFVRS
DLGPSYGGWQVLDATPQERSQGVFQCGPASVIGIREGDVNLSFDMPFIFAEVNADRITWL
YDNTTGKQTKNSVDTRTIGRYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLK
PSASFGATSSMGLEAEERESSISGKFKVTGMLAVGKEVNLVLLLKNLSSDTKTVTVNMTA
WTIVYNGTLVHEVWKDSATMSLDPEEEAEHPVKISYAQYEKYLKSDNMIRITAVCKVPDE
PGVVVERDIILDNPTLTLEVLDEARVQKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGN
LKIDVPTLRPKERSRVRFEILPTRSGTKQLLADFSCNKFHAIKAMLSVDVVE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaggttcaggatcaaggtggtctctgccctgtggtgcttttacggaggagag
tcagctctaggactccagagtatcaactggcagacggccctcaaccgacaagcgcatcac
acacacaagttctccagccaggagctcatcttgcggagaggccaaaacttccaggtctta
atgctcatgaacaaaggccttggctctagcgaaagactggaattcattgtctccacaggg
ccttacccctccgagtcggccatgacgaaggctgtgtttccactctccaatggcagtagc
ggtggctggagtgcggtgcttcaggccagcaatggcaatactctgactattagcatttcc
agtcctgccagcgcacccataggacggtacacaatggccctccagatctcctcccagggc
ggcatctcctctgtgaaacttgggacgttcatactgctttttaacccctggctgaacgcg
gatagcgtctttatgggtaaccatgctgagagagaagagtatgttcaggaagatgccggc
atcatctatgtgggaagcacaaatcgaattagcatgattggctggaactttggacagttt
gaagaagacattctgagcatctgcctctcaatcttggataggagtctgaacttccgccgt
gaccctgctactgatgtggcccgcagaaatgaccccaaatacgttggccgggtgctgagt
gccatgatcaatagcaatgatgacaatggtgtgcttgctgggaattggagtggcacttac
acgggtggtcgtgacccaaggaactggaacggcagcgtggagatcctcaaggactggaaa
aaatctggcttcagcccagtccgatatggccagtgctgggtctttgctgggaccctcaac
acagcgctgcggtctttggggattccttcccgggtgatcaccaacttcagctccgctcat
gatacagaccgaaatctcagtgtggatgtgtactacgaccccatgggaaaccccctggac
aggggtagtgatagtgtatggaatttccatgtctggaatgaaggctggtttgtgaggtct
gacctgggtccctcgtacggtggatggcaggtgttggatgctaccccgcaggaaagaagc
caaggggtgttccagtgtggccccgcttcggtcattggcattcgagagggtgatgtgaac
ctgagcttcgacatgccctttatcttcgcggaggtgaatgccgaccgcatcacctggctg
tatgataacaccaccggcaaacagacaaagaattccgtggacactcgcaccattggcagg
tacatcagcaccaaggcagtgggaagtaacgctcgcatggacgtcacggacaagtacaag
tatccagaaggctctgaccaggaaagacaagtgttccaaaaggctttggggaaacttaaa
cccagtgcgtcatttggcgcaacgtcttcaatgggtttggaagcagaggaacgggagtcc
agcatcagcgggaagttcaaggtcactggcatgctggcagtgggcaaagaagtcaacctg
gtcctactgctcaaaaacctgagcagcgatacgaagacagtgacagtgaacatgacagcc
tggaccattgtctacaacggcacacttgtacatgaggtgtggaaggactctgccacaatg
tccctggaccctgaggaagaggcagagcatcctgtaaagatctcgtacgctcagtatgaa
aagtacctgaagtccgacaacatgatccggatcacagccgtgtgcaaggtcccagatgaa
cctggggtggtggtggagcgggacatcatcctggacaaccccaccttgaccctggaggtg
ctggatgaggctcgtgtgcagaagcctgtgaacgtgcagatgctcttctccaatccactg
gatgagccagtgagggactgtgtgctgatggtggagggaagcggcctgctgttgggtaac
ctgaagattgatgtgccgaccctacgtcccaaggagcggtcccgggtccgttttgagatc
ctgcccacccggagtggcaccaagcaactgctcgccgacttctcctgcaacaagttccat
gcaatcaaggccatgctgtctgtcgacgtagtcgaatga

DBGET integrated database retrieval system