KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530054
Entry
108530054         CDS       T04641                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04217  Necroptosis
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05164  Influenza A
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05205  Proteoglycans in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108530054 (TLR4)
   04066 HIF-1 signaling pathway
    108530054 (TLR4)
   04151 PI3K-Akt signaling pathway
    108530054 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108530054 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    108530054 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    108530054 (TLR4)
   04620 Toll-like receptor signaling pathway
    108530054 (TLR4)
   04621 NOD-like receptor signaling pathway
    108530054 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108530054 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108530054 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108530054 (TLR4)
   05321 Inflammatory bowel disease
    108530054 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108530054 (TLR4)
   05135 Yersinia infection
    108530054 (TLR4)
   05133 Pertussis
    108530054 (TLR4)
   05134 Legionellosis
    108530054 (TLR4)
   05152 Tuberculosis
    108530054 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108530054 (TLR4)
   05161 Hepatitis B
    108530054 (TLR4)
   05171 Coronavirus disease - COVID-19
    108530054 (TLR4)
   05164 Influenza A
    108530054 (TLR4)
   05162 Measles
    108530054 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108530054 (TLR4)
   05144 Malaria
    108530054 (TLR4)
   05145 Toxoplasmosis
    108530054 (TLR4)
   05140 Leishmaniasis
    108530054 (TLR4)
   05142 Chagas disease
    108530054 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108530054 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rbb04054]
    108530054 (TLR4)
   04090 CD molecules [BR:rbb04090]
    108530054 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108530054 (TLR4)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    108530054 (TLR4)
Pattern recognition receptors [BR:rbb04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   108530054 (TLR4)
CD molecules [BR:rbb04090]
 Proteins
  108530054 (TLR4)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Hyaluronan
  Cell surface receptors
   108530054 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_1 LRR_9 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 108530054
NCBI-ProteinID: XP_017728201
UniProt: A0A2K6K4W7
LinkDB
Position
Un
AA seq 843 aa
MTSALRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNIPFSTKNLD
LSFNPLRHLGSYSFFRFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPKYFSNLTNLEHL
DLSSNKIQSIYCKDLQVLHQMPLPNLSLDLSLNPINFIQPGAFKEIRLHKLTLRSNFDGL
NVMKTCIQGLAGLEVHRLVLGEFRNERNLEEFDKSALEGLCNLTIEEFRLAYLDYYLNNI
IDLFNCLANVSSFSLVSVTIKRVEDFSHNFRWQHLELVNCKFEQFPTLELESLKRLTFTA
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQNDFGTTSLKYLDLSFNDVITMGSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFDGLLSLKILKMAG
NSFQENFLPDIFTDLKNLTFLDLSQCQLEQLSPTAFDTLNKLRVLNMSHNNFFSLDTFPY
KCLRSLQVLDYSLNHIMTSKNQELQHFPSSLAYLNLTQNGFACTCEHQSFLKWIKDQRQL
LVDVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVFSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFKLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGQHIFWRRLRKALLDGRSWNPEEQWVQDAISKKPQLSE
EEK
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgacatctgccttgcgcctggctgggaccctgatcccagccatggccttcctctcctgc
gtgagaccagaaagctgggagccctgcgtggaggtggttcctaacattacttatcaatgc
atggagctgaatttctacaaaatccccgacaacatccccttctcaaccaagaacctggac
ctgagctttaatcccctgaggcatttaggcagctatagcttcttccgttttccagaactg
caggtgctggatttatccaggtgtgaaatccagacaattgaagatggggcatatcagagt
ctaagccacctctccaccttaatattgacaggaaaccccatccagagtttagccctggga
gccttttctggactatcaagtttacagaagctggtggctgtggagacaaatctagcatct
ttagagaacttccccattggacatctcaaaactttgaaagaacttaatgtggctcacaat
cttatccagtctttcaaattacctaagtatttttctaatctgaccaatctagagcacttg
gacctttccagtaacaagattcaaagtatttattgcaaagacttgcaggttctacatcaa
atgcccctacccaatctctctttagacctgtccctgaaccctataaactttatccaacca
ggtgcatttaaagaaattaggcttcataagctgactttgagaagtaattttgatggttta
aatgtaatgaaaacttgtattcaaggtctggctggtttagaagtccatcgtttggttctg
ggagaatttagaaatgaaagaaacttggaagagtttgacaaatctgctctggagggattg
tgcaatttgaccattgaagaattccgattagcatacttagactactacctcaataatatt
attgacttatttaattgtttggcaaatgtttcttcattttccctggtgagtgtgactatt
aaaagggtagaagacttttctcataatttcagatggcaacatttagaattagttaactgt
aaatttgaacagtttcccacattggaactcgaatctctcaaaaggcttactttcactgcc
aacaaaggtgggaatgctttttcagaagttgatctaccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaaaatgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatgatgttattaccatgggttcaaactttttgggc
ttagaacaactagaacatctggatttccagcattccaatttgaaacagatgagtgagttt
tcggtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatcttcgatggcttgctcagtctcaaaatcttgaaaatggctggc
aattctttccaggaaaacttccttccagatatcttcacagatctgaaaaacttgaccttc
ctggacctctctcagtgtcaactggagcagttgtctccaacagcatttgacacactcaac
aagcttcgggtactaaatatgagccacaacaacttcttttcattggatacgtttccttat
aagtgtctgcgctccctccaggttcttgattacagtctcaatcacataatgacttccaaa
aaccaggaactacagcattttccaagtagtctagcttacttaaatcttactcagaatggc
tttgcttgtacttgtgaacaccagagtttcctgaagtggatcaaggaccagaggcagctc
ttggtggacgttgaacgaatggaatgtgcaacaccttcagataaacagggcatgccggtg
ctgagtttgaatattacctgtcagatgaataagaccatcattggtgtgtctgtgttcagt
gtgcttgtggtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacatctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgagctagtaaagaatttagaagaaggggtg
cctccctttaagctctgccttcactacagagactttattcccggtgtggccattgctgca
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtgtcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgcaggcataatcttcattgtcctgcagaaggtggagaagaccctgctcagg
cagcaggtggagctgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggcagcacatcttctggagacgactcagaaaagccctgctggatggcagatcg
tggaatccagaagaacagtgggtacaagatgcaattagcaagaagccacaactatctgaa
gaggaaaaataa

DBGET integrated database retrieval system