KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530233
Entry
108530233         CDS       T04641                                 

Gene name
APC2
Definition
(RefSeq) APC2, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04310  Wnt signaling pathway
rbb04390  Hippo signaling pathway
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04810  Regulation of actin cytoskeleton
rbb04934  Cushing syndrome
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05213  Endometrial cancer
rbb05217  Basal cell carcinoma
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108530233 (APC2)
   04390 Hippo signaling pathway
    108530233 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108530233 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108530233 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530233 (APC2)
   05206 MicroRNAs in cancer
    108530233 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108530233 (APC2)
   05225 Hepatocellular carcinoma
    108530233 (APC2)
   05226 Gastric cancer
    108530233 (APC2)
   05217 Basal cell carcinoma
    108530233 (APC2)
   05213 Endometrial cancer
    108530233 (APC2)
   05224 Breast cancer
    108530233 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108530233 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    108530233 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108530233 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108530233 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108530233 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108530233 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rbb04812]
    108530233 (APC2)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108530233 (APC2)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108530233 (APC2)
Cytoskeleton proteins [BR:rbb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     108530233 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Arm_APC_u3 APC_r Suppressor_APC Arm SAMP bZIP_1 APG6_N HALZ
Other DBs
NCBI-GeneID: 108530233
NCBI-ProteinID: XP_017728477
LinkDB
Position
Un
AA seq 2390 aa
MGLLGLLSLLHSAFFGDQTLQELKMASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHL
SKLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPAL
GPEPASRTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYY
SQLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRA
SRLEQIDKELLEAQDRVQQTEPQALLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVV
FWLLSMLATRDQEDTQRARYWTMSSSPESWRGMRPPGSVCQLLLQILHGTEAAAGGRAGA
PGAPGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGA
PEGGGASGAPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMT
RDPLNLALRRYAGMTLTNLTFGDVANKATLCARRSCMEAIVAQLASDSEELHQVVSSILR
NLSWRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQV
DGALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHL
TSHSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNL
LAHRPAKHQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQALEHLEKHRPPAAEATT
KKPLPPLRHLDGLAQDYASDSGCFDDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQ
ALARTPPTRRGGKEAEKDASGEAAVAAKAKAKLALAVARIDQLVEDISALHTSSDDSFSL
SSGDPGQEAPREGRAQSCSPCRGPDAGRREAGSRAHPLLRLKAAHASLSNDSLNSGSASD
GYCPREHMLPCPLAALASRREDPRCGQPRPSRLDLDLPGSQAEPPAREATSADARVRTIK
LSPTYQHVPLLEGASRVGAEPLAGPGTSPGARKQAWLPADHLSKVPEKLAAAPLSVASKA
LQKLVAQEGPLSLSRCSSLSSLSSAGRPGPSEGGDLDDTDSSLEGLEEAGPGEAELDSVW
RAPGATSLPVAIPAPRRNRGRGLGMEDATPSSSSENYVQETPLVLSRCSSVSSLGSFESP
SIASSIPSDPCSGQGSGTISPSELPDSPGQTMPPSRSKTPPLAPAPQGPPEASQFSLQWE
SYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHEHYVQQDVEL
RLLPSACPERGGGAGGAGLHFAGHRRREEGPAPTGSRPRGAADQELELLRECLGTAVPAR
LRKVASALVPGRRALPVPVYMLVPAPAPAQEDDSCTDSAEGTPVNFSSAASLSDETLQGP
PRDQPGGPAGRQRPTGRPTSARQAVGHRHKAGGAGRSAEQARGTGKNRAGLELPLGRPPS
APADKDDSKPGRTRGDGALQSLCLTTPTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIP
RALTRERLQGRKEVPAPSKATPSTPPPARAQPSLIADETPPCYSLSSSASSLSEPEPPEP
PSVSPRGREPAVTKDPGPGGGRDSSPSPRAAEELLQRCISSALPRRRPPVSSLRRRKPRA
TRLDERPAEGSREHGEEAAGSDRASDLDSVEWRAIQEGANSIVTWLHQAAAATREPSSES
DSILSFVSGLSVGSTLQPPKHRKGRQAGGEMGSARRPEKRGAASAKTSGSPRSPAGPEKP
RGTQKTTPGVPAVLRGRTVIYVPSPAPRAQPKGTPGPRVTPRKVAPPCLAQSAAPAKVPS
SGQQRSRSLHRPGKTSELAALSQPPRSATPPARLAKTPSSSSSQTSPASQPLPRKRPPVT
QAAGPLPGPGASPVPKTPARTLLAKQHKTQRSPVRIPFMQKPARRGXAPAGSAVPEARPR
GGRTEAGPGAPRVGRPGLVRVAFGPLQRSESXDRSGFRRQLTFIKESPGLAPPTRSGLSS
AESRPLPPQATSPRRGRPPLPARHSSASSRCGRAPSGTPAGPARRGPRGRPGPGERPAAH
QPPRGPFPACPLRAPAPAERVKRYASLPHISDGPRPDSAAPACPTQADAARRSSDGEPPA
AVRVAARRATTWRRIRDEDVPHILRSTLARTALPLRGSTPEDXPAGPRPRRPATLLVQDE
EVGAPKTNSSTSPRPGEQEPPGLGQLSLLCSDVDGPSLSKAPISAPFVQEAXGVAVGGLP
AAGNGSPSRSGPKRKQGAALGLKSRHVEPGCGASRWARRCAGAALGRGRRPPQTGRQRAA
HDGTLVQTPGRLTFGPQPRDAGYQLGRPQGSLESGSARPSRGRRGQWKED
NT seq 7173 nt   +upstreamnt  +downstreamnt
atggggctcctggggctcctgagcctgctgcactcggccttcttcggggaccagacactg
caggagctgaagatggcgagctccgtggcaccctacgagcagctggtacggcaggtggag
gccttgaaggctgagaacagtcacctgaggcaggagctacgggacaactctagccacctg
tccaagctggagacagagacgtcaggcatgaaggaggtcctgaagcacctacagggaaaa
ctggagcaggaggcccgagtgctggtgtcctcggggcagacggaggtgctggagcagttg
aaggccctgcagatggacatcaccagcctgtacaacctcaagttccagccgcccgccctg
ggcccggaacctgcctcccggacccccgagggcagcccggtacacggctccgggccttcc
aaggacagctttggggagctgagccgggccaccatccggctgctggaggaactggaccgg
gaacggtgtttcctgctgaatgagattgagaaggaggagaaggagaagctctggtactac
tctcagctgcagggcctgtccaagcgcctggacgagctgccgcacgtggagacgcagttc
tcgatgcagatggacctgatccggcagcaacttgagttcgaggcccagcacatccgctcg
ctgatggaggagcgcttcggcacctcggacgagatggtgcagcgggcacagatccgcgcc
tcgcgcctggagcagattgacaaggagctgctggaggcgcaggaccgagtgcagcagaca
gagccccaggccttgctggccgtgaagtcggtgccggtggacgaggacccagagacagag
gtccccacacaccctgaggatggcacccctcagccgggcaacagcaaggtggaggtggtc
ttctggctgttgtccatgttggcgacgcgcgaccaggaggatacacagcgcgcacgctac
tggaccatgtcaagctcgcccgagagctggcgtggcatgcgtccgccggggtctgtctgc
caactgctgctgcaaatcctccacggcactgaggccgcggccgggggtcgcgccggggcc
ccaggagcaccgggcgccaaagacgcacgcatgcgcgccaacgcggcgctgcacaacatc
gtcttctcgcagccggaccagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctg
gagcagatccgtgcctactgcgagacctgctgggactggctgcaggcccgagacggggcg
cccgagggaggcggcgccagcggcgccccggtccccatcgagccgcagatctgccaggcc
acctgtgcggttatgaagctgtcctttgacgaggagtaccgccgtgccatgaacgagcta
ggtgggctgcaggccgtggcagagctgctgcaggttgactatgagatgcacaagatgacc
cgggacccgctgaacctggcgctgcgccgctacgcgggcatgaccctcaccaacctcacc
tttggggacgttgccaacaaggccaccctgtgtgcgcgccggagctgcatggaggccatc
gtggcccagctggcctcggacagtgaggagctccaccaggtggtgtccagcatccttcgg
aacttgtcctggagggccgacatcaacagcaagaaggtgctgagggaggcgggcagcgtg
acagccctggtgcagtgtgtcctgcgggccaccaaggagtccaccctgaagagtgtgctg
agtgccctgtggaatctgtctgcacacagcacggagaacaaggcggccatctgccaggtg
gacggcgccctgggcttcctggtgagcaccctgacctacaagtgccagagcaactcgctg
gccatcatcgagagcggtggcggcatcctccgtaacgtatccagcctcatcgccacccgt
gaggactacaggcaggtgctccgggatcacaactgcctacagacgctgttgcagcatctg
acctcgcacagcctgaccatcgtgagcaacgcatgtggcacactctggaacctatcggcc
cgcagcgcgcgagaccaggagctgctgtgggacctgggcgccgtcggcatgctacgcaat
ctggtgcactccaaacacaagatgatcgccatgggcagcgccgccgccctgcgcaacctg
ctggcccatcgacctgccaagcaccaggcggccgccaccgccgtgtccccaggcagctgc
gtgcccagcctgtacgtgcgcaagcagcgggcgctggaggccgagctggacgcacggcac
ctggcgcaggcgctggagcacctggagaagcatcgcccgccagcagccgaggccaccacc
aagaagccgctgccgcccctgcgacacctggacggcctggcccaagactatgcttccgat
tctggctgctttgacgacgacgatgcaccatcatccctggccgcggccgcagccaccggg
gagccagccagccctgccgcgttgtccctcttcctgggcagccccttcctgcaggggcag
gcgctggcccgcaccccgcccacccgccgaggcggcaaggaggcagagaaggacgccagt
ggggaggctgccgtggcggccaaggccaaggcaaagctggcacttgcagtggcgcgcatc
gaccagctggtggaggacatctccgccctgcatacctcgtccgacgatagcttcagcctc
agctctggagacccgggacaggaggcgccacgggagggccgcgcccagtcatgctcccca
tgccgcggcccggacgccgggcggcgagaggcaggaagccgggcgcacccgctgctgcgg
ctcaaggcggcccatgccagcctctccaacgacagcctcaacagtggcagtgccagcgac
gggtactgcccacgcgaacacatgctgccctgcccactggccgcactggcttcgcgccgc
gaggaccccaggtgtgggcagcctcggcccagccggcttgaccttgacctgccgggtagc
caggccgagccgccggcccgtgaagccacatccgctgacgcccgcgtgcgtaccatcaag
ctgtcacctacctaccagcacgtgccactgctggagggtgcctcaagggtgggtgcagag
cccctcgcggggcctggaacctctccaggggcgcggaagcaggcctggctgccggcagac
cacctgagcaaagttcctgagaagctagcagccgccccgctgtccgtggccagcaaggca
ctgcagaagctggtggcgcaggagggaccgctctccttgtcccgatgcagctccctttcc
tcactgtcctctgccggccgcccaggccccagcgagggcggtgacctggatgacactgac
tcctctctcgaggggctggaggaggcgggccccggcgaggctgagctggacagcgtgtgg
cgggcacccggggccacctcgctgcccgtagccattccggctccccggcgcaaccgaggc
cggggcctggggatggaggacgccactccgtccagctcctcagagaactacgtgcaggag
acaccgctggtgctgagccgctgcagctctgtgagctcgctgggtagcttcgagagcccg
tccattgccagctccatccccagtgacccttgcagcgggcagggcagcggcaccatcagc
cctagcgaactgcccgacagccccgggcagaccatgcctcccagccggagcaagacgccg
ccgctagcgcccgcgccgcagggtccccccgaggccagccaattcagcctgcagtgggag
agctacgtgaagcgcttcctggacatcgccgactgccgagagcgctgccggctgccgtcg
gagctggacgcaggcagcgtgcgcttcaccgtggagaagccggatgagaacttctcgtgc
gcctcgagcctcagcgcgctggccttgcacgagcactacgtgcagcaggacgtggagctg
cggttgctgccctcggcctgcccagagcgcggcgggggcgcagggggcgctggcctccac
tttgcagggcaccggcggcgggaggaggggccggcgcccacgggttctcgcccccgcggt
gccgcggaccaggagttggagctgctgcgggagtgcctggggaccgccgtgcctgccagg
ctgcgcaaggtggcctcggcgctggtgccaggtcgccgcgcgctccccgtgcccgtctac
atgttggtgcccgcccctgccccggcccaggaggacgactcctgcaccgactccgcggag
ggcacgccagtcaacttctccagcgccgcctccctcagcgacgagacactgcagggaccc
cccagggaccagcccgggggaccagcgggcaggcaaagacccaccgggcgccccacctct
gccaggcaggccgtggggcaccggcacaaagcgggaggcgccggccgcagcgcggagcag
gctcggggcaccggcaagaaccgagcagggctggagctgcccctgggccggcccccgagc
gcccccgcagacaaggacgactcgaagcccggccggacccgtggggacggtgcgctccag
tcgctgtgcctcaccacgcccaccgaggaggccgtgtactgcttctacggcaacgactcg
gacgaggagcccccggcagctgcgcccacgcccacccaccggcgcacatcggccatcccc
cgcgctcttacccgcgagcgcctgcagggccggaaggaggtccctgccccgtccaaggcc
acaccatccaccccgccgcccgcccgggcccagcccagcctcattgctgacgagaccccg
ccgtgctactccctgagctcctccgccagctccctcagcgagcccgagcccccggagccg
ccctccgtcagtccacgaggccgggagcccgcggtcaccaaggacccgggcccgggaggc
ggacgcgacagctcgcccagcccgcgggccgcggaggagcttctgcagcggtgcatcagc
tcggccctgcccaggcgccggccccctgtgtccagcctgcggcgccgcaagccccgagcc
acccggctggatgagcggcctgcggaggggtcccgggagcacggcgaggaggcagcgggc
tcagaccgggcctctgacctggacagcgtggagtggcgcgccatccaggagggcgccaac
tccatcgtcacgtggctgcaccaggcagcagctgccacacgcgagccctcgtccgagtcc
gactccatcctgtcctttgtatccgggctgtcggtagggtctaccctacagccccccaaa
cacaggaagggacgacaggcggggggcgaaatgggcagtgcccggcggccagagaaacgg
ggcgcagcctcggccaagacgagcgggagcccccgttcccctgcaggcccggagaagcca
cgtggcacacagaagaccacgcccggggtgccagctgtgctccggggacgaacagtaatc
tatgtgcccagcccggcacctcgtgcccagcccaaagggacccccggcccccgcgtcaca
ccgcggaaggtggcgcccccttgcctggcacagtccgcagctccagccaaagtccccagc
tccggacagcagcggtcgcggagcctacaccggcctgggaagacctcggagctggcggcg
ctgagccagccccccaggagcgctacaccgcccgcccgcctcgccaagaccccctcctcc
agctcctcccagacctcgcccgcctcccagcccctgcccagaaagcgccccccggtcacc
caggctgcagggcccctgcccggccccggggcctccccagtgcccaagacgccggcgcgc
acccttctggcgaagcagcacaagacgcagaggtcgcccgtgcggatcccgttcatgcag
aagccggcccggcggggcnncgcccccgctggctcggcagtcccggaggcccgccccagg
ggcgggcggaccgaggctggcccgggggcgccgcgggttggccgccctgggctggtgcgc
gtggccttcggccctctccagcgcagcgagtccntcgaccgctcaggcttccggcgacag
ctgaccttcatcaaggagtcaccggggcttgcgccgccgacccgctccgggctatcctcg
gccgagtcgcggcctctgcccccccaggccacctcgccccgtcgcggccgcccgccgctg
cccgcgcgtcattcctctgcctcctcgcgctgcggaagagctccgagcggcacccccgca
ggccccgcccggcgcggcccccgcggccgacccggccccggcgagcgccctgccgcgcac
cagcctccgagaggcccgttcccggcctgcccgttgcgcgcgcctgcgccggccgagcgc
gtcaagcgctacgcgtcgctgccgcacatcagcgatggcccgagacccgacagcgccgct
ccggcctgccccacccaggcggacgccgcgcgccgcagcagcgacggagagccccccgcc
gccgtcagagtggctgcccgccgggccacgacgtggcggcgcatccgagacgaagacgtg
ccgcacatcctgcgcagcacgctggcccgcacggccctgccactgcggggctccacgccc
gaggacngcccggccggcccccggccgcgcagaccagcgacgctgctggtccaggacgag
gaggtcggcgcccccaagaccaactccagcacgtccccgaggcctggagagcaggagccc
cccgggctgggccagctctccctcctttgcagcgacgtggacgggcccagcctctccaag
gctcccatctccgcacccttcgtgcaagaggccnntggggtcgccgtgggggggcttccg
gccgccggcaacggctcccccagccgctcgggcccgaagaggaaacagggcgcggcgctg
ggcctcaagtcccggcacgtggagcccggctgcggggccagccgctgggcccgccgctgc
gcaggggcagcgctggggaggggacggcgcccgccgcagactggaaggcagcgggctgcg
cacgatgggaccctggtgcagacaccgggccggctgacatttggaccccagcccagagat
gctggctaccagctggggcgaccccaagggtcgctggagtcaggatcggcccggcccagc
cgcggcaggcgaggtcaatggaaagaagactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540305
Entry
108540305         CDS       T04641                                 

Gene name
APC
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04310  Wnt signaling pathway
rbb04390  Hippo signaling pathway
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04810  Regulation of actin cytoskeleton
rbb04934  Cushing syndrome
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05213  Endometrial cancer
rbb05217  Basal cell carcinoma
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108540305 (APC)
   04390 Hippo signaling pathway
    108540305 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108540305 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108540305 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540305 (APC)
   05206 MicroRNAs in cancer
    108540305 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108540305 (APC)
   05225 Hepatocellular carcinoma
    108540305 (APC)
   05226 Gastric cancer
    108540305 (APC)
   05217 Basal cell carcinoma
    108540305 (APC)
   05213 Endometrial cancer
    108540305 (APC)
   05224 Breast cancer
    108540305 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108540305 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    108540305 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108540305 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108540305 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108540305 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108540305 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rbb04812]
    108540305 (APC)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108540305 (APC)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108540305 (APC)
Cytoskeleton proteins [BR:rbb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     108540305 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 108540305
NCBI-ProteinID: XP_017744786
LinkDB
Position
Un
AA seq 2851 aa
MYASLGSGPVAALPVSVPPSTLRSWSTGCSRSCVRQETKSPGGARTSGHWASVWQEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRGFVNGSRESIGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILR
IRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVAEINMATSGNGQGSTTRMDHETAS
VLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
GLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALV
AQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLS
ALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNE
DHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNL
IHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLS
ETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNAGNMTVLSPYLNTTV
LPSSSSSRGSLDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKV
MEEVSAIHTSQEDRSSGSTTELHCVTDERNALRRSSAAHAHSNTYNFTKSENSNRTCSMP
YAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHS
ANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQSEQRQSRS
QSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLC
QEDVYEDDKPTNYSERYSEEEQHEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDIPSSQ
KQSFSFSKSSSGQSTKTEHISSSSENTSTPSSNAKRQNQLHPSSAQSRSGQTQKAVTCKV
SSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSANTLQIAEIKDKI
GTRSTEDPVSEVPAVSQHTRTKSSRLQGSSLSSESTRHKAVEFSSGAKSPSKSGAQTPKS
PPEHYVQETPLMFSRCTSISSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTM
PPSRSKTPPPPPQTAQTKRETPKNKTPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHF
ATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNEKQEK
EAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQ
LPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAA
GEGVRAGAQSGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSA
MPKGKSHKPFRVKKIMGQVQQASASSSATNXNQLDGKXKKPTSPVKPIPQNTEYRTRIRK
HADSKNNLNAERVFSDNKDSKKQNLKNNSKDFNDKLPNNEDRVRGSFAFDSPHHYTPIEG
TPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSASKTQ
AIAKHPINRGQLKPILQKQSTFPQSSKDIPERGAATDEKLQNFAIENTPVCFSHNSSLSS
LSDIDQENNNNKENEPIKETEPPDTQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSL
SIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGILAEDLTLDLKDTQRPDSEH
GLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHL
TPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEIS
GQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQMATTS
PRGAKSSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSIS
PGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASS
IPRSESASKGLNQVNNGNGANKKIELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSP
TLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPN
LSPTIEYNDGRPVKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSS
SSILSASSESSEKQKXGXKHVNSISGTKQSKENQVSAKGTWRKIKENEISPTNSTSQTIS
SGATNGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGN
PNKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTETKPGQNNPVPVSETN
ESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNN
TKKRDSKTDSTESSGTQSPKRHSGSYLVTSV
NT seq 8556 nt   +upstreamnt  +downstreamnt
atgtacgcctccctgggctcgggtccggtcgctgctttgcccgtttctgtaccaccctca
actctccggtcctggagcaccggctgcagcaggagctgcgtccggcaggagacgaaaagc
ccaggcggcgctcgtacttctggccactgggcgagcgtctggcaggaagtacttaaacaa
ctacaaggaagtattgaagatgaagctatggcttcttctggacagattgatttattagag
cgtcttaaagagcttaacttagatagcagtaatttccctggagtaaaactacggtcaaaa
atgtccctccgttcttatggaagccgggaaggatctgtatcaagccgttctggagagtgc
agtcctgttcccatgggttcatttccaagaagagggtttgtaaatggaagcagagaaagt
attggatatttagaagaacttgagaaagagaggtcgttgcttcttgctgatcttgacaaa
gaagaaaaggaaaaagactggtattatgctcaacttcagaatctcactaaaagaatagat
agtcttcctttaactgaaaatttttccttacaaacagatatgaccagaagacaattggaa
tatgaagcgaggcaaatcagagttgcaatggaagaacaactgggtacctgccaggatatg
gaaaaacgagcacagcgaagaatagccagaattcagcaaatcgaaaaggacatacttcgt
atacgacagcttttacagtcccaagcaacagaagcagagaggtcgtctcagaacaagcat
gaaaccggctcacatgatgctgagcggcagaatgaaggtcaaggagtggcagaaatcaac
atggcaacttctggtaatggtcagggttcaactacacgaatggaccacgaaacagccagt
gttttgagttctagtagcacacactctgcacctcgaaggctgacaagtcatctgggaacc
aaggtggaaatggtgtattcattgttgtcaatgcttggtactcatgataaggatgatatg
tcgcgaactttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaagactctgtattgttg
ggaaattcccggggcagtaaagaggctcgggccagggccagtgcagcactccacaacatc
attcactcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttg
gaacagatacgcgcttactgtgaaacctgttgggagtggcaggaagctcatgaacaaggc
atggaccaggacaaaaatccaatgccagctcctgttgaacatcagatctgtcctgctgtg
tgtgttctaatgaaactttcatttgatgaagagcatagacatgcaatgaatgaactaggg
ggactacaggccattgcagaattattgcaagtggactgtgaaatgtatgggcttactaat
gaccactacagtattacactaagacgatatgctggaatggctttgacaaacttgactttt
ggagatgtagccaacaaggctacgctatgctctatgaaaggctgcatgagagcacttgtg
gcccaactaaaatctgaaagtgaagacttacagcaggttattgcaagtgttttgcggaat
ttgtcttggcgagcagatgtaaatagtaaaaagacgttgcgggaagttggaagtgtgaaa
gcattgatggaatgtgctttagaagttaaaaaggaatcaaccctcaaaagcgtattgagt
gccttatggaatttgtcagcacattgcactgagaataaagctgatatatgtgctgtagat
ggtgcacttgcatttttggttggcactcttacttaccggagccagacaaacactttagcc
attattgaaagtggaggtgggatattacggaatgtgtccagcttgatagctacaaatgag
gaccacaggcaaattctaagagagaacaactgtctacagactttattacaacacttaaaa
tctcatagtttgacaatagtcagtaatgcttgtggaactttgtggaatctctcagcaaga
aatcctaaagaccaggaagcattatgggacatgggggcagttagcatgctcaagaacctc
attcattcaaagcacaaaatgattgctatgggaagtgctgcagctttaaggaatctcatg
gcaaataggcctgcgaagtacaaggatgccaatattatgtctcctggctcaagcttgcca
tctcttcatgttaggaaacaaaaagccctagaagcagaattagatgctcagcatttgtca
gaaacttttgacaatatagacaatttaagtcccaaggcatctcatcgtagtaagcaaaga
cacaagcaaagtctctatggtgattatgtttttgacaccaatcgacatgatgataatagg
tcagataattttaatgctggcaacatgactgtcctttcaccatatttgaatactacagtg
ttacccagctcctcttcatcaagaggaagcttagatagttctcgttctgaaaaagataga
agtttggagagagaacgaggaattggtctaggcaactaccatccagcaacagaaaatcca
ggaacctcttcaaagcgaggtttgcagatctccaccactgcagcccagattgccaaagtc
atggaagaagtgtcagccattcatacctctcaggaagacagaagttctgggtctaccact
gaattacattgtgtgacagatgagagaaatgcacttagaagaagctctgctgcccatgca
cattcaaacacttacaatttcactaagtcagaaaattcaaataggacatgttctatgcct
tatgccaaattagaatacaagagatcttcgaatgatagtttaaatagtgtcagtagtagt
gatggttatggtaaaagaggtcaaatgaaaccctcaattgaatcctattctgaagatgat
gaaagtaagttttgcagttatggtcaatacccagccgacctagcccataaaatacatagt
gcaaatcatatggatgataatgatggagaactagatacaccaataaattatagtcttaaa
tattcagatgagcagttgaactctggaaggcaaagtccttcacagaatgaaagatgggca
agacccaaacacgtaatagaagatgaaataaaacaaagtgagcaaagacaatcaaggagt
caaagtacaacttatcctgtttatactgagagcactgatgataaacacctgaagttccaa
ccacattttggacagcaggaatgtgtttctccatacaggtcacggggagccaacggttca
gaaacaaatcgagtgggttctaatcatggaattaatcaaaatgtaagccagtctttgtgt
caagaagatgtctatgaagatgataagcctaccaattatagtgaacgttactctgaagaa
gaacagcatgaagaagagagaccaacaaattatagcataaaatacaatgaagagaaacat
catgtggatcagcctattgattatagtttaaaatatgccacagatattccttcgtcacag
aaacagtcattttcattctcaaagagttcatctggacaaagcactaaaactgaacatatc
tcttcaagcagtgagaatacgtccacaccttcatctaatgccaagaggcagaatcagctc
catccaagttctgcacagagtagaagtggtcagactcaaaaggctgtcacttgcaaagtt
tcttctattaaccaagaaacaatacagacttattgtgtggaagatactccaatatgtttt
tcaagatgtagttcattatcatctttgtcatcagccgaagatgaaataggatgtgatcag
acgacacaggaagcagattctgctaataccctgcaaatagcagaaataaaagacaagatt
ggaactaggtcaactgaagaccctgtaagcgaagttccagcagtgtcgcagcacactaga
accaaatccagcagactgcagggttctagtttatcttcagaatcaaccaggcacaaagct
gttgaattttcttcaggagcaaaatctccctccaaaagtggtgctcagacacccaaaagt
ccacctgaacactatgttcaggagactccacttatgtttagcagatgtacttccatcagt
tcacttgatagttttgagagtcgttcgattgccagctccgttcagagtgaaccatgcagt
ggaatggtaagtggcattataagccccagtgatcttccagatagccctggacaaaccatg
ccaccaagcagaagtaaaacccctccaccaccacctcaaacagctcaaaccaagcgagaa
acacctaaaaataaaacacctactgccgaaaagagagagagtggacctaagcaagctgca
gtaaatgctgcagttcagcgggtccaggttcttccagatgctgatactttattacacttt
gccacagaaagtactccagatggattttcttgttcatctagcctgagtgctctgagcctc
gatgagccatttatacagaaagatgtggaattaagaataatgcctccagttcaggaaaat
gacaatgggaatgaaacagaatcagagcaacctaaagaatcaaatgaaaagcaagagaaa
gaggcagaaaaaactattgattctgaaaaggacctattagatgattcagatgatgatgat
attgaaatactagaagaatgtattatttctgccatgccaacaaagtcatcacgtaaagca
aaaaagccagcccagactgcttcaaaattacctccacctgtggcaaggaaaccaagtcag
ctgcctgtgtacaaacttctgccatcacaaaacaggttgcaaccccaaaagcatgttagt
tttacaccgggagatgatatgccacgagtgtattgtgtagaagggacacctataaacttt
tccacagctacatctctaagtgatctaacaatagaatcccctccaaatgagttagctgct
ggagaaggagttagagcaggggcacagtcaggtgaatttgaaaaacgagataccattcct
acagaaggcagaagtacagatgaggctcaaggaggaaaaacctcatctgtaaccatacct
gaattggatgacaataaagcagaggaaggtgatattcttgcagaatgcattaattctgct
atgcccaaagggaaaagtcacaagcctttccgtgtgaaaaagataatgggccaagtccag
caagcatctgcgtcctcttctgcaaccaacnaaaatcagttagatggtaagnaaaagaaa
ccaacttcaccagtaaaacctataccacaaaatactgaatatcggacacgtataagaaaa
catgcagactcaaaaaataatttaaatgctgagagagttttctcagacaacaaagattca
aagaaacagaatttgaaaaataattccaaggacttcaacgataagctcccaaataatgaa
gatagagtcagaggaagttttgcttttgattcacctcatcattacacacctattgaagga
actccttactgtttttcacgaaatgattctttgagttctctagattttgatgatgatgat
gttgacctttccagggaaaaggctgaattaagaaaggcgaaagaaaataaagaatcagaa
gctaaagttaccagccacacagaactaacctccaaccaacaatcagctagtaagacacaa
gctattgcaaagcatccaataaatcgaggtcagcttaaacccatactgcagaagcaatcc
acttttccccagtcatccaaagacataccagaaaggggggcagcaactgatgaaaaatta
cagaattttgctattgaaaatactccagtttgcttttctcataattcctctctgagttct
ctcagtgacattgaccaagaaaacaacaacaataaagaaaatgaacctatcaaagagact
gagccccctgatacacagggagaaccaagtaaacctcaagcatcaggctatgctccaaaa
tcgtttcatgttgaagataccccagtttgtttttcaagaaacagttctctcagttctctt
agtattgactctgaagatgacctgttgcaggaatgtataagctccgcaatgccaaaaaag
aaaaagccttcaagacttaagggtgataatgaaaaacatagtcccagaaatatgggtggc
atattagctgaagatctgacacttgatttgaaagatacacagagaccagattcagaacat
ggtttatcccctgattcagaaaattttgattggaaagctattcaggaaggtgcaaattcc
atagtaagtagtttacatcaagctgctgctgctgcatgtttatctagacaagcttcgtct
gattcagattccatcctttccctgaaatcaggaatctctctgggatcaccatttcatctt
acacctgatcaagaagaaaaaccctttacaagtaataaaggcccacgaattctaaaacca
ggggagaaaagtacattggaaactaaaaagatagaatctgaaagtaaaggaatcaaagga
ggaaaaaaagtttataaaagtttgattactggaaaagttcgatctaattcagaaatttca
ggccaaatgaagcagccccttcaagcaaacatgccttcaatctctcgaggcaggacaatg
attcatattccaggagttcgaaatagctcctcaagtacaagtcctgtttctaaaaaaggc
ccaccccttaagactccagcctccaaaagccctagtgaaggtcaaatggccaccacttct
cctagaggagccaagtcatctgtgaaatcagaattaagccctgttgccaggcagacatct
caaataggtgggtcaagtaaagcaccttctagatcaggatctagagattcgaccccttca
agacctgcccagcaaccattaagtagacctatacagtctcctggccgaaactcaatttcc
ccaggtagaaatggaataagtcctcctaacaaattatctcagcttccaaggacatcatct
cctagtactgcttcaactaagtcctcaggttctggaaaaatgtcgtatacatctccaggc
agacagatgagccaacagaaccttaccaaacaaacaggtttatccaagaacgccagtagt
attccaagaagtgagtctgcctccaaagggctaaatcaggtgaataatggtaatggagcc
aataaaaagatagaactttctagaatgtcttcaactaaatcaagtggaagtgaatctgat
agatcagaaagacctgtattagtacgccagtcaactttcatcaaagaagctccaagccca
accttaagaagaaaattggaggaatctgcttcatttgaatctctttctccatcgtctaga
ccggcttctcccactaggtcccaggcacaaactccagttttaagtccttcccttcctgat
atgtctctatccacacattcatctgttcaggctggtggatggcgaaaactaccccctaat
ctcagtcccactatagagtataatgatggaagaccagtaaagcgccatgatattgcacgg
tctcattctgaaagtccttctagacttccgatcaataggtcaggaacctggaaacgtgag
cacagcaaacattcatcatcccttcctcgagtaagcacttggagaagaactggaagttca
tcttcaattctttctgcttcatcagaatccagtgaaaagcaaaagtgaggatgaaaacat
gtgaactctatttcaggaaccaaacaaagtaaagaaaaccaagtatccgcaaaaggaaca
tggagaaaaataaaagaaaatgaaatttctcccacaaatagtacttctcagaccatttcc
tcaggtgctacaaatggtgctgaatcaaagactctaatttatcaaatggcacctgctgtt
tctaaaacagaggatgtttgggtaagaattgaggactgtcccattaacaatcctagatct
ggaagatctcccacaggtaatactcccccggtgattgacagtgtttcagaaaagggaaat
ccaaacaaagattcaaaagataatcaggcaaaacaaaatgtgggtaatggcagtgttccc
atgcgtaccgtgggtttggaaaatcgcctgaactcctttattcaggtagatgcccctgac
cagaaaggaactgagacaaaaccaggacaaaataatcctgtccctgtatcagagactaat
gaaagttctatagtggagcgtaccccattcagttctagcagctcaagcaaacacagttca
cctagtgggactgttgctgccagagtgactccttttaattacaacccaagccctaggaaa
agcagcgcagatagcacttcagctcggccgtctcagatcccaactccagtgaataacaac
acaaagaagcgagattcaaaaactgacagcacagaatccagtggaacccaaagtcctaag
cgtcattctgggtcttaccttgtgacatccgtttaa

DBGET integrated database retrieval system