KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530296
Entry
108530296         CDS       T04641                                 

Definition
(RefSeq) complement receptor type 1-like
  KO
K04011  complement component (3b/4b) receptor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04610  Complement and coagulation cascades
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05144  Malaria
rbb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108530296
   04610 Complement and coagulation cascades
    108530296
   04613 Neutrophil extracellular trap formation
    108530296
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108530296
   05152 Tuberculosis
    108530296
  09174 Infectious disease: parasitic
   05144 Malaria
    108530296
   05140 Leishmaniasis
    108530296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108530296
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rbb04090]
    108530296
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108530296
CD molecules [BR:rbb04090]
 Proteins
  108530296
SSDB
Motif
Pfam: Sushi HRM
Other DBs
NCBI-GeneID: 108530296
NCBI-ProteinID: XP_017728958
LinkDB
Position
Un
AA seq 303 aa
LTVRKLALLFSLSPVCQLPPDVLHGERTQRDKDIFWPGQEVFYSCEPGYDLRGAASLHCT
PQGDWSPAAPTCEVKSCDDYLGQLPNGRVLFPLNLQLGAKVDFLCDEGFRLKGSSASYCV
LAGMESLWNSSVPVCEQIFCPTPPVIPNGRHTGKPLEVFPFGKAVTYTCDPHPDRGMTFD
LIGESTIRCTSDPQGNGVWSSPAPRCGILGHCKAPDHFLFAKLKTQTNASDFPIGTSLKY
ECRLEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPLNGMVHVITDIQVGSRINYSC
TTG
NT seq 913 nt   +upstreamnt  +downstreamnt
tttaacagtgagaaaattagcactacttttttctctctccccagtatgtcagctgcctcc
ggatgtcctgcatggtgagcgtacccaaagggacaaggacatcttttggcctgggcagga
agtgttctacagctgtgagcccggctatgacctcagaggggctgcgtctctgcactgtac
accccagggagactggagccctgcagcccccacatgtgaagtgaaatcctgtgatgacta
cctgggccagcttcctaatggtcgtgtgctatttccacttaatctccagcttggagcaaa
agtggattttctttgtgacgaaggatttcgattaaaaggcagctctgctagttactgtgt
cttggctggaatggaaagcctttggaatagcagtgttccagtgtgtgaacaaatcttttg
tccaactcctccagttattcctaatgggagacacacaggaaaacctctggaagtctttcc
ctttggaaaagctgtaacttacacatgtgacccccacccagacagagggatgaccttcga
tctcattggggagagcaccatccgctgcacaagtgaccctcaagggaatggggtttggag
cagccctgcccctcgctgtggaattctgggtcactgtaaagccccggatcattttctgtt
tgccaagttgaaaacccaaaccaatgcatctgactttcccattgggacatctttaaagta
cgaatgccgtcttgagtactacgggaggccgttctctatcacatgtctagataacctggt
gtggtcgagtcccaaagatgtctgtaaacgtaaatcatgtaaaactcctccagatccact
gaatggcatggtgcacgtgatcacagacatccaggttggatccagaatcaactattcttg
tactacagggtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539534
Entry
108539534         CDS       T04641                                 

Gene name
CR1
Definition
(RefSeq) complement C3b/C4b receptor 1 (Knops blood group)
  KO
K04011  complement component (3b/4b) receptor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04610  Complement and coagulation cascades
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05144  Malaria
rbb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108539534 (CR1)
   04610 Complement and coagulation cascades
    108539534 (CR1)
   04613 Neutrophil extracellular trap formation
    108539534 (CR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108539534 (CR1)
   05152 Tuberculosis
    108539534 (CR1)
  09174 Infectious disease: parasitic
   05144 Malaria
    108539534 (CR1)
   05140 Leishmaniasis
    108539534 (CR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108539534 (CR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rbb04090]
    108539534 (CR1)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108539534 (CR1)
CD molecules [BR:rbb04090]
 Proteins
  108539534 (CR1)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 108539534
NCBI-ProteinID: XP_017743780
LinkDB
Position
Un
AA seq 1026 aa
MHAVRTLMRHVQHNYFPLFAFRHRLIGHSSAECIISDHTAHWSTKPPICQRIPCGLPPTI
ANGDFISTNREYFHYGSVVTYRCNLGSGGRKVFELVGEPSIYCTSKDDQVGIWSGPAPQC
IIPNKCMPPNVENGILVSVNRSLFFLNEVVEFRCQPGFVMKGPRRVQCQALNKWEPELPS
CSRVCQPPPEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAVSLHCTPQGDWSPEAPR
CAVKSCDDFLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGRRSLWNNS
VPVCEHIFCPNPPAILNGRHTGTLLGDIPYGKEISYTCDPHPDRGMTFKLIGENTIRCTS
DPQGNGVWSSPAPRCELSVRAGHCKTPEQFPFARPTIPINDFEFPVGTSLNYECRPGYFG
RMFSISCLENLVWSSVEDNCRRKSCGTPPEPFNGMVHINTDTQFGSTVNYSCNKGFRLIG
SPSTTCLVSGNNVMWDKEAPICEIISCKPPPTISNGDFYSNNRISFHSGTVVTYQCHTGP
DGEQLFELVGERSIYCTSKDDQVGVWSSPPPQCISTNKCTAPEVENGIRVPGNRSFFSLN
EIVRFRCQPGFVMVGSHTVQCQTNDRWGPKLPHCSRVCQPPPEILHGEHTPSHQDNFSPG
QEVFYSCEPGYDLKGAASLHCTPQGDWSPEAPTCTVKSCDDFLGQLPHGRVLFPLNLQPG
AKVSFVCDEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPLGD
IPYGKEISYTCDPHPDRGMTFDLIGESTIRCTSDPQGNGVWSSPAPRCELSVPAACPHPP
KIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGIIFCTDQGIWSQLDHYCKEVNCSFP
QFMNGISKELEMKKVYHYGDYVTLECEDGYALEGSPWSQCQEDDRWDPPLAICTSRARDA
LIVGTLSGMIFILFIIFLPWIILKYRKDNNAHEKPKEVAIHIQSQGGSSVHPQTLQTNEE
NSSVFP
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgcatgctgtgaggacgttgatgaggcatgtacagcacaattattttccattgtttgcc
tttaggcaccgactcattggtcactcatctgctgaatgtatcatctcagaccatactgcc
cattggagcacaaagccgccaatttgtcaacgaattccttgtgggctacccccaaccatt
gccaatggagatttcattagcaccaacagagagtattttcactatggatctgtggtgacc
taccgctgcaatcttggaagcggagggagaaaggtgtttgagcttgtgggtgagccctcc
atatactgcaccagcaaagatgatcaagtgggcatctggagcggcccggcccctcagtgc
attatacctaacaaatgtatgcctccaaatgttgaaaatggaatattggtatctgtcaac
agaagcttatttttcttaaatgaagttgtggagtttaggtgtcagcctggctttgtcatg
aaaggaccccgccgtgtgcaatgccaggccctgaacaaatgggagccagagttaccaagc
tgctccagggtgtgtcagccgcctccagaaatcctgcatggtgagcataccccaagccat
caggacaacttttcacccgggcaggaagtgttctacagctgtgagcccggctatgacctc
agaggggctgtgtctctgcactgcacgccccagggagactggagccctgaagcccccaga
tgtgcagtgaaatcctgtgatgacttcttgggtcaactccctcatggccgtgtgctgttt
ccacttaatctccagcttggagcaaaggtgtcctttgtctgtgatgaagggtttcgctta
aagggcagctccgttagccattgtgtcttggttggaaggagaagcctttggaataacagt
gttcctgtgtgtgaacatatcttttgtccaaatcctccagctatccttaatgggagacac
accggaactctccttggagatattccctatggaaaagaaatatcttacacatgtgacccc
cacccagacagagggatgaccttcaaactcattggggagaacaccattcgctgcacaagt
gaccctcaagggaatggggtttggagcagccccgcccctcgctgtgaactttctgttcgt
gctggtcactgtaaaaccccagagcagtttccatttgccaggcccacaatcccaattaat
gactttgagtttccagtcgggacatctttgaattatgaatgccgtcctgggtattttggg
agaatgttctctatctcctgcctagaaaacttggtctggtcaagtgttgaagacaactgt
agacgaaaatcatgtggaactcctccagaacccttcaatggaatggtgcatataaacaca
gatacccagtttggatcaacagttaattattcttgtaataaagggtttcgactcattggt
tccccatctactacttgtctcgtctcaggcaataatgtcatgtgggataaggaggcacct
atttgtgagatcatatcttgtaagccacctccaaccatatccaatggagacttctacagc
aacaacagaatatcttttcacagtggaacagtggtaacttaccagtgccacactggacca
gatggagaacagctgtttgagctcgtgggagaacggtcaatatattgcaccagcaaagat
gatcaagttggtgtttggagcagccctccacctcaatgtatttctactaataaatgcaca
gctccagaagttgaaaacggaattagagtaccaggaaataggagtttcttttccctcaat
gagatcgtgagatttagatgtcagcctggctttgtcatggtagggtcccacactgtgcag
tgccagaccaacgacagatgggggcccaagctgccacactgctccagggtgtgtcagcca
cctccagaaatcctgcatggtgagcatactccaagtcatcaggacaacttttcacctggg
caggaagtgttctacagctgtgagcccggctatgacctcaaaggggctgcgtctctgcat
tgcacgccccagggagactggagccctgaagcccccacatgtacagtgaaatcctgtgat
gacttcctgggccaactccctcatggccgtgtgctgtttccactcaatctccagcctggg
gcaaaggtgtcctttgtttgcgatgaagggttccgattaaaaggcaggtctgctagtcat
tgtgtcttggctggaatgaaagccctttggaatagcagtgttccagtgtgtgaacaaatt
ttttgcccaaatcctccagctatacttaatgggagacacacaggaactccccttggagat
attccctatggaaaagaaatatcttacacatgcgacccccacccagacagagggatgacc
ttcgaccttattggggagagcaccatccgctgcacaagtgaccctcaagggaatggggtt
tggagcagccctgcccctcgctgtgaactttctgttcctgctgcctgcccacatccaccc
aagatccaaaacgggcattacattggaggacacgtatctctatatcttcctgggatgaca
atcagctacatttgtgaccccggctacctgttagtgggaaagggcatcattttctgtaca
gaccagggaatctggagccaactggatcattattgcaaagaggtaaattgtagcttccca
cagtttatgaatggaatctcgaaagagttagaaatgaaaaaagtgtatcactatggagat
tacgtgactttggagtgtgaagatgggtatgcgctggaaggcagtccctggagccagtgc
caggaggatgacagatgggaccctcctctggccatatgtacctctcgtgcacgtgatgct
ctaatagttggcactttatctggtatgatctttattttattcatcattttcctcccttgg
ataattctaaagtacagaaaagacaataatgcacatgaaaaacctaaagaagtggctatc
catatacagtctcaaggaggcagcagcgttcatccccaaactctgcaaacaaatgaagaa
aatagcagtgtctttccttga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539535
Entry
108539535         CDS       T04641                                 

Definition
(RefSeq) complement component receptor 1-like protein
  KO
K04011  complement component (3b/4b) receptor 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04610  Complement and coagulation cascades
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05144  Malaria
rbb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108539535
   04610 Complement and coagulation cascades
    108539535
   04613 Neutrophil extracellular trap formation
    108539535
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108539535
   05152 Tuberculosis
    108539535
  09174 Infectious disease: parasitic
   05144 Malaria
    108539535
   05140 Leishmaniasis
    108539535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108539535
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rbb04090]
    108539535
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108539535
CD molecules [BR:rbb04090]
 Proteins
  108539535
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 108539535
NCBI-ProteinID: XP_017743781
UniProt: A0A2K6KMJ4
LinkDB
Position
Un
AA seq 568 aa
MAPPVLLERPFPSRRFPGLLLAALVLRVSFSDQCNAPEQLPFARPTNLTDASEFPVGTHL
KYECRPGYYGRPFSIICLKNSVWTSAKDKCTRKSCRNPKEPVNGMVHVIKDIQFGSQINY
SCNKGYRLIGSSSATCIISGNTVIWDNETPVCERIPCGLPPTIANGDFFSTNREYFHYGS
VVTYRCNLGSGGRKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGILV
SVSRSLFSLNEVVEFRCQPGFVMKGPHRVQCQALNKWEPELPSCSRVCQPPPDVLHGERT
QRDKDNFWPGQEVFYSCEPGYDLRGAASLRCTPQGDWSPAAPTCEVKSCDDFLGQLLNGH
VLFPLNLQLGAKVDFVCDEGFRLKGSSASYCVLAGMESLWNSSVPVCERKSCKTPPDPVN
GTVHVITDIQVGSRINYFCTTGHRLIGHSSAECVISGNTAHWSTKPPICQQIFCPNPPAI
LNGRHTGAPLGDIPYGKEISYTCDPHPDRGMTFNLIGESTIHCTSDSQGNGVWSSPAPRC
ELSVPAGANDALIVGKFYEGFAEEFWHL
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggcgcctcccgtccttctcgagcgtccctttccttcccggcgctttcctgggttgctt
ctggcggccctggtgttgcgggtgtccttctccgatcaatgcaatgccccggaacagctt
ccatttgccaggcctaccaacctaactgatgcatctgagtttcccgttgggacacatctg
aagtatgaatgccgccctggttattatggaagaccattttctatcatctgcctaaaaaac
tcagtctggacaagtgctaaggacaagtgcacacgtaaatcatgtcgtaatcctaaagaa
cctgtgaatggcatggttcatgtgatcaaagacatccagttcggatcccaaattaattat
tcttgtaataaaggataccgactcattggttcctcttcggccacatgcatcatctcaggc
aatactgtcatttgggataatgaaacacctgtttgtgagagaattccttgtgggctaccc
cccaccatcgccaatggagatttctttagcaccaatagagagtattttcactacggatct
gtggtgacctaccgctgcaatcttggaagcggagggagaaaggtgtttgagctcgtgggt
gagccctccatatactgcaccagcaaagatgatcaagtgggcatctggagcggcccggct
cctcagtgtattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattggtg
tctgtcagcagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcctggc
tttgtcatgaaaggaccccaccgtgtgcaatgccaggccctgaacaaatgggagccagag
ttaccaagctgctccagggtatgtcagccgcctccggatgtcctgcatggtgagcgtacc
caaagggacaaggacaacttttggcctgggcaggaagtgttctacagctgtgagcccggc
tatgacctcagaggggctgcgtctctgcgctgcacaccccagggagactggagccctgca
gcccccacatgtgaagtgaaatcctgtgatgacttcctgggccagcttcttaatggccat
gtgctatttccacttaatctccagcttggagcaaaagtggattttgtttgtgatgaagga
tttcgattaaaaggcagctctgctagttactgtgtcttggctggaatggaaagcctttgg
aatagcagtgttccagtgtgtgaacgtaaatcatgtaaaactcctccagatccagtgaat
ggcacagtgcatgtgatcacagacatccaggttggatccagaatcaactatttttgtact
acagggcaccgactcattggtcactcatctgctgaatgtgtcatctcaggcaatactgcc
cattggagcacgaagccgccaatttgtcaacaaatcttttgcccaaatcctccagctatc
cttaatgggagacacacaggagctccccttggagatattccctatggaaaagaaatatct
tacacatgtgacccccacccagacagagggatgaccttcaacctcattggggagagcacc
atccactgcacaagtgactctcaagggaatggggtttggagcagccctgcccctcgctgt
gaactttctgttcctgctggtgcaaatgacgctcttatagttggtaagttttatgaaggg
tttgctgaggaattctggcatctttaa

DBGET integrated database retrieval system