KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530611
Entry
108530611         CDS       T04641                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04110  Cell cycle
rbb04114  Oocyte meiosis
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05161  Hepatitis B
rbb05162  Measles
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05215  Prostate cancer
rbb05222  Small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108530611 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108530611 (CCNE1)
   04114 Oocyte meiosis
    108530611 (CCNE1)
   04115 p53 signaling pathway
    108530611 (CCNE1)
   04218 Cellular senescence
    108530611 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530611 (CCNE1)
   05206 MicroRNAs in cancer
    108530611 (CCNE1)
   05203 Viral carcinogenesis
    108530611 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    108530611 (CCNE1)
   05215 Prostate cancer
    108530611 (CCNE1)
   05222 Small cell lung cancer
    108530611 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108530611 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108530611 (CCNE1)
   05161 Hepatitis B
    108530611 (CCNE1)
   05162 Measles
    108530611 (CCNE1)
   05169 Epstein-Barr virus infection
    108530611 (CCNE1)
   05165 Human papillomavirus infection
    108530611 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rbb03032]
    108530611 (CCNE1)
   03036 Chromosome and associated proteins [BR:rbb03036]
    108530611 (CCNE1)
DNA replication proteins [BR:rbb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    108530611 (CCNE1)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    108530611 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 108530611
NCBI-ProteinID: XP_017729085
UniProt: A0A2K6KZ45
LinkDB
Position
Un
AA seq 410 aa
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVAVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNTVCADPCSLIPTPDKEDDERVYPNSSCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAVLSEQNRASPLPSGLLTPPQSSKKQSSEPEMA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggt
ggcgcagagttctcggctcgctccaggaagaggaaggcaaacgtggccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtgggagccag
ccttgggacaataatacagtctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgagcgggtttacccaaactcatcgtgcaagcctcggattattgcaccatcc
agaggctccccgctgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagggagaccttttacttggcacaggatttctttgaccggtatatggcgacacag
gaaaatgttgtaaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcatatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgctggatctctgtgtcctggatgttgactgcctcgaatttccttatggtatacttgct
gcttcagccttgtatcatttctcttcatctgaattgatgcaaaaggtttcaggatatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
acggggagctcaaaactgaagcacttcaggggcgttgctgatgaagatgcacacaacata
cagacccacagagacagcttggatttgctggacaaagcccgagcaaagaaagccgtgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcacccctccacagagcagt
aagaagcagagcagcgagccagaaatggcgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539896
Entry
108539896         CDS       T04641                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04110  Cell cycle
rbb04114  Oocyte meiosis
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05161  Hepatitis B
rbb05162  Measles
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05215  Prostate cancer
rbb05222  Small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108539896 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108539896 (CCNE2)
   04114 Oocyte meiosis
    108539896 (CCNE2)
   04115 p53 signaling pathway
    108539896 (CCNE2)
   04218 Cellular senescence
    108539896 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539896 (CCNE2)
   05206 MicroRNAs in cancer
    108539896 (CCNE2)
   05203 Viral carcinogenesis
    108539896 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    108539896 (CCNE2)
   05215 Prostate cancer
    108539896 (CCNE2)
   05222 Small cell lung cancer
    108539896 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108539896 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108539896 (CCNE2)
   05161 Hepatitis B
    108539896 (CCNE2)
   05162 Measles
    108539896 (CCNE2)
   05169 Epstein-Barr virus infection
    108539896 (CCNE2)
   05165 Human papillomavirus infection
    108539896 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rbb03032]
    108539896 (CCNE2)
   03036 Chromosome and associated proteins [BR:rbb03036]
    108539896 (CCNE2)
DNA replication proteins [BR:rbb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    108539896 (CCNE2)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    108539896 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 108539896
NCBI-ProteinID: XP_017744326
LinkDB
Position
Un
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTESPQEVQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFXNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHEKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLSLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYIHTFSKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagcctcagcccagccagacggaa
tcaccccaagaagtccagataatccaggccaagaagaggaaaaccacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctgggggaatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttnaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgaaaaacattttgaagttctgcattctgacttggaaccacag
atgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcacagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttgaaatgggaactttgtcct
gtaacaatcatctcctggctaagtctctttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcaatattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactgactgctgctgcc
ttgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaaattatttggccatgctggaagaagtaaattacatacacaccttcagcaaaggggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcaccgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system