KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530653Help
Entry
108530653         CDS       T04641                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00480  Glutathione metabolism
rbb00980  Metabolism of xenobiotics by cytochrome P450
rbb00982  Drug metabolism - cytochrome P450
rbb00983  Drug metabolism - other enzymes
rbb01524  Platinum drug resistance
rbb05200  Pathways in cancer
rbb05204  Chemical carcinogenesis
rbb05225  Hepatocellular carcinoma
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    108530653 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108530653 (MGST2)
   00982 Drug metabolism - cytochrome P450
    108530653 (MGST2)
   00983 Drug metabolism - other enzymes
    108530653 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    108530653 (MGST2)
   05204 Chemical carcinogenesis
    108530653 (MGST2)
   05225 Hepatocellular carcinoma
    108530653 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    108530653 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    108530653 (MGST2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108530653 (MGST2)
Transporters [BR:rbb02000]
 Other Transporters
  Pores ion channels [TC:1]
   108530653 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 108530653
NCBI-ProteinID: XP_017729150
UniProt: A0A2K6KM17
LinkDB All DBs
Position
Un
AA seq 147 aa AA seqDB search
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PVFIITLWMAGWYFNQVFATCLGLMYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFMDEYLDLNIAKKLRRQF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaactcgatcctgctggctgctgtctctattctctcggcctgtcagcaaagt
tattttgctttgcaagttggaaaggcaagattaaaatacaaagttacacccccagcagtc
actgggtcaccagagtttgagagagtatttcgggcacaacaaaactgtgtggagttttat
cctgtattcataattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctgatgtacatatatggccgtcacctgtacttctggggatattcagaagct
gctaaaaaacggatcactggtttccgattgagtctggggattttggccttgttgaccctc
ctgggtgccctgggaattgcaaacagctttatggatgaatatctggacctcaatattgcc
aagaaactgaggcggcaattctaa

DBGET integrated database retrieval system