KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530701
Entry
108530701         CDS       T04641                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04110  Cell cycle
rbb04218  Cellular senescence
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108530701 (RB1)
   04218 Cellular senescence
    108530701 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530701 (RB1)
   05203 Viral carcinogenesis
    108530701 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108530701 (RB1)
   05225 Hepatocellular carcinoma
    108530701 (RB1)
   05226 Gastric cancer
    108530701 (RB1)
   05214 Glioma
    108530701 (RB1)
   05220 Chronic myeloid leukemia
    108530701 (RB1)
   05218 Melanoma
    108530701 (RB1)
   05219 Bladder cancer
    108530701 (RB1)
   05215 Prostate cancer
    108530701 (RB1)
   05224 Breast cancer
    108530701 (RB1)
   05222 Small cell lung cancer
    108530701 (RB1)
   05223 Non-small cell lung cancer
    108530701 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108530701 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108530701 (RB1)
   05161 Hepatitis B
    108530701 (RB1)
   05160 Hepatitis C
    108530701 (RB1)
   05163 Human cytomegalovirus infection
    108530701 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108530701 (RB1)
   05169 Epstein-Barr virus infection
    108530701 (RB1)
   05165 Human papillomavirus infection
    108530701 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108530701 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108530701 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108530701 (RB1)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108530701 (RB1)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    108530701 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B FAM75
Other DBs
NCBI-GeneID: 108530701
NCBI-ProteinID: XP_017729212
LinkDB
Position
Un
AA seq 819 aa
MPPKTPRKTAAAAAAAAAEPPALPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTA
LCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMPFTFTE
LQKNIEIRTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKETAVIPINGSPRTPRRG
QNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVIF
SFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTV
NPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLS
IQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFY
KVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHFESA
CPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQTTSAFQTQKPLKSTSLSL
FYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMY
GICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNIL
QYASTRPPTLSPIPHIPRSPYKFPTSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRS
RILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSK
HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgccgcccaaaactccccgaaaaacggccgccgccgccgccgctgctgccgcggaaccc
ccggcactgccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccg
gaggacctgcctctggtcaggcttgagtttgaagaaaccgaagaacctgattttactgcg
ttatgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggag
aaagtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgg
ggaatctgtatctttattgcagcagttgacctagatgagatgccattcacttttactgag
ctacagaaaaacatagaaatcaggacatgtgaacttatatatttgacacaacccagcagt
tcgatatctactgaaataaattctgcattggtgctaaaagtttcttggatcacattttta
ttagctaaagaaacagctgttatacccattaatggttcacctcgaacacccaggcgaggc
cagaacaggagtgcacggatagcaaaacaactagaaaatgatacacgaattattgaagtt
ctctgtaaagaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaatttt
ataccttttatgaattctcttggacttgtaacatctaatgggcttccagaggtaatcttt
agttttgaaacacagagaacaccacgaaaaagtaaccttgatgaagaggtgaatgtgatt
cctccacacactccagttaggactgttatgaacactatccaacaattaatgatgatttta
aattcagcaagtgatcaaccttcagaaaatctgatttcctattttaataactgcacagtg
aatcccaaagaaagcatactgaaaagagtgaaggatataggatacatctttaaagagaaa
tttgctaaagctgtgggacagggatgtgtcgaaattggatcacagcgatacaaacttgga
gttcgcttgtattaccgagtaatggaatccatgcttaaatcagaagaagaacgattatcc
attcaaaattttagcaaacttctgaatgacaacatttttcatatgtccttattggcgtgt
gctcttgaggttgtaatggccacatatagcagaagtacatctcagaatcttgattctgga
acagatttgtctttcccatggattctgaatgtgcttaatttgaaagcctttgatttttac
aaagtgattgaaagttttataaaagcagaaggcaacttgacaagagaaatgataaaacac
ttagaacgatgtgaacatcgaatcatggaatcccttgcatggctctcagattcaccttta
tttgatcttattaaacaatcaaaggaccgagaaggaccaactgatcactttgaatctgct
tgtcctcttaatcttcctctccagaataatcacactgcagcagatatgtatctttctcct
gtaagatctccaaagaaaaaaggttcaactacacgtgtaaattctactgcaaatgcagag
acacaaacaacctcagccttccagacccagaagccattgaaatctacctctctttcactg
ttttataaaaaagtgtatcggctagcttatctccggctaaatacactatgtgaacgcctt
ctatctgaacacccagaactagaacacatcatctggacccttttccagcacacgctgcag
aatgagtatgaactcatgagagacaggcatttggaccaaattatgatgtgttccatgtat
ggcatatgcaaagtgaagaatatagaccttaaattcaaaatcatcgtaacagcatataag
gatcttcctcatgctgttcaggagacattcaaacgtgttttgatcaaagaagaggagtat
gattctattatagtattctataactcggtcttcatgcagagactgaaaacaaatattttg
cagtatgcttccaccaggccccctaccttgtcaccaatacctcacattcctcgaagtcct
tacaagtttcctacttcacccttacggattcctggagggaacatctatatttcacccctg
aagagtccatataaaatttcagaaggtctcccaacaccaacaaaaatgactccaagatca
aggatcttagtatcaattggtgaatcatttgggacttctgagaagttccagaaaataaat
cagatggtgtgtaacagcgaccgtgtgctcaaaagaagtgctgaaggaagcaaccctcct
aaaccgctgaaaaaactacgctttgatattgaaggatcagatgaagcagatggaagtaaa
catctcccaggggagtccaaatttcagcagaaactggcagaaatgacttctactcgaaca
cgaatgcaaaagcagaaaatgaatgatagcatggatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system