KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530826
Entry
108530826         CDS       T04641                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04145  Phagosome
rbb04620  Toll-like receptor signaling pathway
rbb04640  Hematopoietic cell lineage
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05202  Transcriptional misregulation in cancer
rbb05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108530826 (CD14)
   04064 NF-kappa B signaling pathway
    108530826 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108530826 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108530826 (CD14)
   04620 Toll-like receptor signaling pathway
    108530826 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108530826 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108530826 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108530826 (CD14)
   05133 Pertussis
    108530826 (CD14)
   05134 Legionellosis
    108530826 (CD14)
   05152 Tuberculosis
    108530826 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108530826 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108530826 (CD14)
   04090 CD molecules [BR:rbb04090]
    108530826 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rbb00537]
    108530826 (CD14)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   108530826 (CD14)
CD molecules [BR:rbb04090]
 Proteins
  108530826 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rbb00537]
 Receptors
  108530826 (CD14)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_6
Other DBs
NCBI-GeneID: 108530826
NCBI-ProteinID: XP_017729366
UniProt: A0A2K6LFN2
LinkDB
Position
Un
AA seq 375 aa
MERASSLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIR
VGGLSLEPFLTRVDADGDPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLQE
LTLEDLEITGTMPPLPVEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLGIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPALQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATANPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLYRAPRPDELPEVDNLTLDGNPFLVPGTALPQEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggagcgcgcatcctccttattgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcagcccgactggtccgaagccttccagtgtgtgtctgcagtggaggtggagatccgt
gtcggcggtctcagcctagagccgtttctaacgcgcgtcgatgccgacggcgacccgcgg
cagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtaggagccgcacag
gttcctgctcagctactggtaggcgccctgcgtgtactagcgtactcccgcctccaggaa
ctgacgctcgaggacctagagataaccggcaccatgcctccgctgcctgtggaagccaca
gggcttgcactctccagcttgcgcctacgcaacgtgtcgtgggctacagggcgttcctgg
ctcgctgagctgcagcagtggctcaagccaggcctcaaggtactgggcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgctttcccggccctcaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatcgcggctctctgtccccacaag
ttcccggccctccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgctgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgcaaaccctagcgctccgagatgcatgtggtccagcgccctaaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccggccaagctcaga
gtgctcgatctcagctgcaacagactgtacagggcgccgcggcctgacgagctgcccgag
gtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccaa
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccagggggcccggggctttgcctaa

DBGET integrated database retrieval system