KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530915
Entry
108530915         CDS       T04641                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04510  Focal adhesion
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04921  Oxytocin signaling pathway
rbb05140  Leishmaniasis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05213  Endometrial cancer
rbb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108530915 (ELK1)
   04012 ErbB signaling pathway
    108530915 (ELK1)
   04014 Ras signaling pathway
    108530915 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108530915 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108530915 (ELK1)
   04912 GnRH signaling pathway
    108530915 (ELK1)
   04921 Oxytocin signaling pathway
    108530915 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530915 (ELK1)
   05205 Proteoglycans in cancer
    108530915 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108530915 (ELK1)
   05213 Endometrial cancer
    108530915 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108530915 (ELK1)
   05161 Hepatitis B
    108530915 (ELK1)
   05163 Human cytomegalovirus infection
    108530915 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108530915 (ELK1)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    108530915 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 108530915
NCBI-ProteinID: XP_017729565
UniProt: A0A2K6K5M3
LinkDB
Position
Un
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAMPTVAPAAVH
ATPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtatcctatcctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccgccatgccaactgtggcccctgctgctgtacat
gccaccccaggggacactgcctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccgggtggtttggcacgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccacagccaccccctcatcctcggcctgctgtggtg
ctccccaatgcagctcctgcaggagcagcagcacccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgcctggaggctgaggaggctggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagctgaatgtggagccaggtttg
ggccgggctttgcccccagaggtgaaagtggaagggcccaaggaagagttggaagttgcc
ggggagagagggtttgtgccggaaactaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcaggcggccac
gcggcttccagccctgagatctcccagccacagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccaggacccgaacggaccccaggatcggga
actggctccggcctccaggcacctgggccggcgctaactccgtccctacttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggctaagctctccttccagtttccgtccagt
ggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system