KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108531451
Entry
108531451         CDS       T04641                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108531451 (GADD45B)
   04064 NF-kappa B signaling pathway
    108531451 (GADD45B)
   04068 FoxO signaling pathway
    108531451 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108531451 (GADD45B)
   04210 Apoptosis
    108531451 (GADD45B)
   04115 p53 signaling pathway
    108531451 (GADD45B)
   04218 Cellular senescence
    108531451 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108531451 (GADD45B)
   05202 Transcriptional misregulation in cancer
    108531451 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108531451 (GADD45B)
   05212 Pancreatic cancer
    108531451 (GADD45B)
   05225 Hepatocellular carcinoma
    108531451 (GADD45B)
   05226 Gastric cancer
    108531451 (GADD45B)
   05214 Glioma
    108531451 (GADD45B)
   05216 Thyroid cancer
    108531451 (GADD45B)
   05220 Chronic myeloid leukemia
    108531451 (GADD45B)
   05217 Basal cell carcinoma
    108531451 (GADD45B)
   05218 Melanoma
    108531451 (GADD45B)
   05213 Endometrial cancer
    108531451 (GADD45B)
   05224 Breast cancer
    108531451 (GADD45B)
   05222 Small cell lung cancer
    108531451 (GADD45B)
   05223 Non-small cell lung cancer
    108531451 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    108531451 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108531451 (GADD45B)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     108531451 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108531451 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 108531451
NCBI-ProteinID: XP_017730390
UniProt: A0A2K6LG99
LinkDB
Position
Un
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIMRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagctgctggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggcaaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacattgccctgcaaatccacttcacgctcatccagtcc
ttctgctgcgacaacgacattaacatcatgcgggtgtcgggcatgcagcgcctggcacag
ctcctgggagagccggccgagactcagggcaccactgaggcccgagacctgcattgtctt
ctggtcacgaaccctcacacagacgcctggaagagccacggcttggtggaggtagccagc
tactgcgaagaaagccggggcaacaaccagtgggtgccctacatctctcttcaggaacgc
tga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532870
Entry
108532870         CDS       T04641                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108532870 (GADD45A)
   04064 NF-kappa B signaling pathway
    108532870 (GADD45A)
   04068 FoxO signaling pathway
    108532870 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108532870 (GADD45A)
   04210 Apoptosis
    108532870 (GADD45A)
   04115 p53 signaling pathway
    108532870 (GADD45A)
   04218 Cellular senescence
    108532870 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532870 (GADD45A)
   05202 Transcriptional misregulation in cancer
    108532870 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108532870 (GADD45A)
   05212 Pancreatic cancer
    108532870 (GADD45A)
   05225 Hepatocellular carcinoma
    108532870 (GADD45A)
   05226 Gastric cancer
    108532870 (GADD45A)
   05214 Glioma
    108532870 (GADD45A)
   05216 Thyroid cancer
    108532870 (GADD45A)
   05220 Chronic myeloid leukemia
    108532870 (GADD45A)
   05217 Basal cell carcinoma
    108532870 (GADD45A)
   05218 Melanoma
    108532870 (GADD45A)
   05213 Endometrial cancer
    108532870 (GADD45A)
   05224 Breast cancer
    108532870 (GADD45A)
   05222 Small cell lung cancer
    108532870 (GADD45A)
   05223 Non-small cell lung cancer
    108532870 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    108532870 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108532870 (GADD45A)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     108532870 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108532870 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 108532870
NCBI-ProteinID: XP_017732637
UniProt: A0A2K6MSX6
LinkDB
Position
Un
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcggacgatcactgtcggggtg
tacgaagcggccaaactgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacattctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgagcgagggcgcggagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaactaatttgtttttgccgggaaagtcgctacatggatcagtgggttccggtgatt
aatctccctgaacggtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538612
Entry
108538612         CDS       T04641                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108538612 (GADD45G)
   04064 NF-kappa B signaling pathway
    108538612 (GADD45G)
   04068 FoxO signaling pathway
    108538612 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108538612 (GADD45G)
   04210 Apoptosis
    108538612 (GADD45G)
   04115 p53 signaling pathway
    108538612 (GADD45G)
   04218 Cellular senescence
    108538612 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538612 (GADD45G)
   05202 Transcriptional misregulation in cancer
    108538612 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108538612 (GADD45G)
   05212 Pancreatic cancer
    108538612 (GADD45G)
   05225 Hepatocellular carcinoma
    108538612 (GADD45G)
   05226 Gastric cancer
    108538612 (GADD45G)
   05214 Glioma
    108538612 (GADD45G)
   05216 Thyroid cancer
    108538612 (GADD45G)
   05220 Chronic myeloid leukemia
    108538612 (GADD45G)
   05217 Basal cell carcinoma
    108538612 (GADD45G)
   05218 Melanoma
    108538612 (GADD45G)
   05213 Endometrial cancer
    108538612 (GADD45G)
   05224 Breast cancer
    108538612 (GADD45G)
   05222 Small cell lung cancer
    108538612 (GADD45G)
   05223 Non-small cell lung cancer
    108538612 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    108538612 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108538612 (GADD45G)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     108538612 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108538612 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 108538612
NCBI-ProteinID: XP_017742280
UniProt: A0A2K6LMB7
LinkDB
Position
Un
AA seq 159 aa
MTLEEVRGQDTVPESTDRMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccagaaagcacagacaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtccgcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgactttctgc
gtgctggctgccgatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggcgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcctgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

DBGET integrated database retrieval system