KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108531690Help
Entry
108531690         CDS       T04641                                 

Gene name
HK2
Definition
(RefSeq) hexokinase 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00010  Glycolysis / Gluconeogenesis
rbb00051  Fructose and mannose metabolism
rbb00052  Galactose metabolism
rbb00500  Starch and sucrose metabolism
rbb00520  Amino sugar and nucleotide sugar metabolism
rbb00524  Neomycin, kanamycin and gentamicin biosynthesis
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
rbb04066  HIF-1 signaling pathway
rbb04910  Insulin signaling pathway
rbb04930  Type II diabetes mellitus
rbb04973  Carbohydrate digestion and absorption
rbb05230  Central carbon metabolism in cancer
Module
rbb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rbb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108531690 (HK2)
   00051 Fructose and mannose metabolism
    108531690 (HK2)
   00052 Galactose metabolism
    108531690 (HK2)
   00500 Starch and sucrose metabolism
    108531690 (HK2)
   00520 Amino sugar and nucleotide sugar metabolism
    108531690 (HK2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108531690 (HK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108531690 (HK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108531690 (HK2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108531690 (HK2)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    108531690 (HK2)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    108531690 (HK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108531690 (HK2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108531690 (HK2)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108531690 (HK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 108531690
NCBI-ProteinID: XP_017730762
UniProt: A0A2K6LCD3
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKCSGV
EGRDVVTLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKCLHKTVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEPLQLS
HDQLLEIKRRMKVEMERGLSKETHAIAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLNESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDDGCLDD
FCTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNVLIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcgcatctgctcgcctacttcttcacagagctcaaccatgaccaagtgcag
aaggttgaccagtatctctaccacatgcgcctctctgatgagaccctcttggagatctct
aagcggttccgcaaggagatggagaaagggcttggagccaccacccaccccactgcagca
gtgaagatgctgcccacctttgtgaggtccactccagatgggacagaacacggagagttc
ctggctctggaccttggagggaccaacttccgtgtgctttgggtgaaagtaacggacaat
gggcttcagaaggtggagatggagaaccagatctatgccatccccgaggacatcatgcga
ggcagtggcacccagctgtttgaccacattgccgaatgcctggctaacttcatggataag
ctacaaatcaaagacaagaagctcccattgggttttactttctcattcccctgccaccag
actaaactagacgagagtttcctggtctcatggaccaagggattcaagtgcagtggagtg
gaaggcagagacgttgtgactttgatccggaaggccatccagcggagaggggactttgat
atcgacattgtggctgtggtgaatgacacagttgggaccatgatgacctgtggttatgat
gaccacaactgtgagattggtctcattgtgggcacgggcagcaacgcctgctacatggaa
gagatgcgccacattgacatggtggaaggtgacgaggggcggatgtgtatcaatatggag
tggggggccttcggggacgatggctcgctcaatgacattcgcactgagtttgaccaggag
attgacatgggctcgctgaacccggggaagcaactgtttgagaagatgatcagtgggatg
tacatgggggagctggtgaggcttatcctggtgaagatggccaaggaggagctgctcttt
ggggggaagctcagcccagagctactcaacaccggtcgctttgagaccaaagacatctca
gatatcgaaggggagaaggatggcatccggaaggcccgtgaggtcctgatgcggttgggc
ctggacccgactcaggaggactgtgtggccactcaccgaatctgccagattgtgtccaca
cgctccgccagcctgtgcgcagccaccctggccgccgtgctgcagcgcatcaaggagaac
aaaggcgaggagcggctgcgctctactattggggtcgacggctccgtctacaagaaacac
ccccattttgctaagtgtctacataagaccgtgcggcggctggtgcccgactgcgatgtc
cgcttcctccgctctgaggatggcagtggcaaaggtgcagccatggtgacagcagtggct
taccggctggccgatcaacaccgtgcccgccagaagacactggagcctctgcagctgagc
catgaccagctgttggagatcaagaggaggatgaaggtggaaatggagcgaggtctaagc
aaggagactcacgccattgcccccgtcaagatgctgcccacctacgtgtgtgccacccct
gatggcacagagaaaggggacttcttggccttggaccttggaggaacaaatttccgggtc
ctgctggtgcgtgttcggaacgggaagtggggtggagtggagatgcacaacaagatctac
gccatcccgcaggaggtcatgcacggtactggggatgagctctttgaccacattgtccag
tgcatcgcggacttccttgagtacatgggcatgaagggcgtgtccctgcctctgggtttt
accttctccttcccctgccagcagaatagcctgaacgagagcatcctcctcaagtggaca
aaaggcttcaaggcatctggctgtgagggcgaggacgtggtgaccctgctgaaggaagcg
atccaccggcgagaggagtttgacctggatgtggttgccgtggtgaacgacacagttgga
accatgatgacctgtggctttgaagaccctcactgtgaagttggcctcatcgttggcacg
ggcagcaatgcctgctacatggaggagatgcgcaatgtggaactggtggaaggagaagag
gggcggatgtgtgtgaacatggaatggggggccttcggggacgatggatgcctagatgac
ttctgcacggaatttgatgtggctgtggatgagctttcactcaaccccggcaagcagagg
ttcgagaaaatgatcagtggaatgtacctgggtgagattgtccgtaacgttctcatcgat
ttcaccaagcgtgggctgctcttccgaggccgcatctcagagcggctcaagacgaggggc
atcttcgaaaccaagttcttgtctcagattgagagtgactgcctggccctgctgcaagtc
cgcgccatcctgcaacacttagggcttgagagcacctgtgatgacagcatcattgttaag
gaggtgtgcactgtagtggcccgacgggcagcccagctctgtggcgcaggcatggctgct
gtggtggacaagatacgagaaaaccgtgggctggacgctctcaaagtgacagtgggtgtg
gatgggactctctacaagctacatcctcactttgccaaagtcatgcatgagacagtgaag
gacctggctccaaaatgtgatgtgtcttttcttcagtcagaggatggcagcggaaagggg
gcggcgctcatcactgctgtggcctgccgcatccgtgaggctggacagcgatag

DBGET integrated database retrieval system