KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108531891
Entry
108531891         CDS       T04641                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04621  NOD-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108531891 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    108531891 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 108531891
NCBI-ProteinID: XP_017731009
LinkDB
Position
Un
AA seq 348 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHSANRIQVANLMIQNAGAVS
AVMKTIHIFQKLNYMLLAKRLQEEKEKVDKKYKSVTKPKPLSQAEMSPAASAAIRNDVTK
QRAAPKVSPHVKPEQEQRVAQQESIREGFQKDCLPVMVLKATKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRMIIISRYYQHSGFLEVNSTSCVLDAKSDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNLLFDLSDKTGEMEVLVVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHGIIKVGTAWSKVNSPRG
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggagatactcttgctaacgggcctggataacatcactgatgag
gaactcgataggtttaagttctttctttcagacgagtttaatatcgcgacaggcaaacta
catagtgcaaacagaatacaagtagctaacttgatgattcaaaatgctggtgcagtgtct
gcagtgatgaagaccattcatatttttcagaagttgaattacatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagaaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgagcaggaacagagggtggcc
cagcaggaatctatcagagaagggtttcagaaagactgtttgccggttatggtactgaaa
gcaacaaagcccttcacgtttgagacccaagaaggcaagcaagagatgtttcatgctaca
gtggctacagagaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaatgattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagcacctcatgtgtgttagatgctaaatctgaccaaaaggttaatgtcccgctg
aacattatcagaaaagctggtgaaaccccaaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatgggttgtttgtagtccagaaggtaacagaaaagaagaaaaattta
ttatttgacctaagtgataagactggggaaatggaagtattggtggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatggcatcataaaggtgggaactgcatgg
agcaaagtcaactctccaagggggtga

DBGET integrated database retrieval system